SecReT6
Protein ID: 160899279
SecReT6 ID236
T6SS typei3
Gene symbol-
Locus tagDaci_3845
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T6SS(s) in this replicon]
Location [Strand]4237714..4239045 [+]
Producthypothetical protein
NoteTssL
UniProt IDA9BLJ1
KEGG IDdac:Daci_3845
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 5.80E-70, Aligned region: 49..254
DUF2077 [PF09850], Evalue: 5.80E-70, Aligned region: 259..290
OmpA [PF00691], Evalue: 7.90E-15, Aligned region: 280..304
OmpA [PF00691], Evalue: 7.90E-15, Aligned region: 317..415
Protein Sequence: 443 a.a.     [Download]
>gi|160899279|ref|YP_001564861.1| hypothetical protein Daci_3845 [Delftia acidovorans SPH-1]
MNSSNISHQMPWGGDADTGRAEGAASAAPAPAGQEPLRSNLPDVVSGGNPLVAAANRLLNLIPQIRAMVT
NEDPRALQQLLLEHIREFEQRAGASGVPMETIIGARYCICTVLDETAAQTPWGSAGVWPKHSLLVALHNE
TWGGEKFFQLLARLVQTPHQHIDLIELLYYCVMLGFEGRYRVIDNGRAQLETLKARLLQLIESTRGDRSS
LLSVHWRGVQRLASPPWAMVPLWVAAAITLLLAFFIYLWFSYRLSNSSDDLFAAINEIRFPRTSAAATVA
TLKPRLRQFLEPEIREGLVSVRDEADRSTVILRGDGLFDPAATVVKPRYVQVIHRVAAALDEVPGKVVVN
GYTDNLPIRTARFPSNWNLSQERAQAVSQMLGGSLRDRQRLHAEGRADSDPVAPNNTAEGRALNRRVEIV
LLVAPQQRDQQLQALPAAPETRN
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|160895450|ref|NC_010002.1|:4237714-4239045 Delftia acidovorans SPH-1 chromosome, complete genome
ATGAACAGTTCCAACATCAGCCACCAAATGCCCTGGGGCGGCGACGCCGACACGGGCCGTGCCGAAGGCG
CGGCCAGCGCCGCGCCCGCGCCTGCCGGCCAGGAGCCGCTGCGCTCCAACCTGCCCGACGTGGTCAGCGG
CGGCAACCCGCTGGTGGCCGCCGCCAACCGGCTGCTGAACCTCATCCCCCAGATCCGCGCCATGGTCACC
AACGAGGACCCGCGCGCGCTGCAACAACTGCTGCTCGAGCACATCCGCGAATTCGAGCAGCGCGCAGGCG
CCAGCGGCGTGCCCATGGAAACCATCATCGGTGCACGCTACTGCATCTGCACGGTGCTGGACGAAACCGC
CGCCCAGACGCCCTGGGGCAGTGCCGGCGTCTGGCCCAAGCACAGCCTGCTGGTCGCCCTGCACAACGAA
ACCTGGGGCGGCGAGAAGTTCTTTCAGCTGCTGGCCCGCCTGGTGCAGACGCCGCACCAGCACATCGACC
TGATCGAGCTGCTGTACTACTGCGTGATGCTGGGCTTTGAAGGCCGCTACCGCGTGATCGACAACGGCCG
CGCCCAGCTGGAGACGCTGAAGGCGCGCCTGCTGCAGCTCATCGAATCGACGCGCGGCGACCGCAGCAGC
CTGCTGTCCGTGCACTGGCGTGGCGTGCAGCGCCTGGCCTCGCCGCCCTGGGCCATGGTGCCGCTGTGGG
TGGCGGCTGCAATCACCTTGCTGCTGGCGTTCTTCATCTACCTGTGGTTCAGCTACCGGCTGTCCAACAG
TTCGGACGACCTGTTCGCCGCCATCAACGAGATCCGCTTCCCGCGCACCTCGGCGGCCGCCACCGTCGCC
ACGCTCAAGCCGCGGCTGCGCCAGTTCCTGGAGCCCGAGATCCGCGAAGGCCTGGTCAGCGTGCGCGACG
AGGCCGACCGCAGCACCGTGATCCTGCGCGGCGACGGCCTGTTCGACCCGGCCGCCACCGTCGTGAAGCC
CCGCTACGTGCAGGTCATCCACCGCGTGGCAGCGGCCCTGGACGAAGTGCCGGGCAAGGTCGTCGTCAAC
GGCTACACCGACAACCTGCCCATACGCACGGCGCGCTTCCCGTCCAACTGGAACCTGTCGCAGGAACGTG
CCCAGGCCGTGTCCCAGATGCTGGGCGGCTCGCTGCGCGACCGCCAGCGCCTGCATGCCGAGGGCCGTGC
CGACAGCGACCCCGTCGCCCCCAACAACACGGCAGAAGGCCGGGCGCTGAACCGGCGGGTGGAAATCGTC
CTGCTGGTCGCGCCCCAGCAACGTGACCAGCAACTGCAGGCCCTGCCTGCCGCACCCGAGACCAGGAACT
GA