SecReT6
Protein ID: 160899282
SecReT6 ID236
T6SS typei3
Gene symbol-
Locus tagDaci_3848
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T6SS(s) in this replicon]
Location [Strand]4243450..4244487 [+]
ProductImpA family type VI secretion-associated protein
NoteTssA
UniProt IDA9BLJ4
KEGG IDdac:Daci_3848
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.10E-22, Aligned region: 53..113
ImpA-rel_N [PF06812], Evalue: 1.10E-22, Aligned region: 179..200
Protein Sequence: 345 a.a.     [Download]
>gi|160899282|ref|YP_001564864.1| ImpA family type VI secretion-associated protein [Delftia acidovorans SPH-1]
MANIQDLLTETAAEPPCGPDLTYDNDFQAMESAAQGKVEQQFGDTVIPAEPPDWRDVERQASALMQRTKD
LRVAVLLCRAWTILHGLPGTLQGLQLCGALLERHWEHVHPLPEDGDDYFMRMNALGTLSDVTGFVRDLRN
ADFLRGALGQISVRDAELMAKGNVPEDLPHLTTDELRMASARAHAEGHETLLAVTPALQELDRIRACCEQ
HLPSHQQPELDGLRQLLLALKQWQPQSTGDADTDAETDPAARTGAEGDTEGGTVAHPASGSAPAPARNRE
QAIAQLLEIAAFVERTEPSNPAPLLIRRAARFMRMGFMDILRELSPDSLAQVEVITGAHLQEQQT
 
Nucleotide Sequence: 1038 bp     [Download]
>gi|160895450|ref|NC_010002.1|:4243450-4244487 Delftia acidovorans SPH-1 chromosome, complete genome
ATGGCCAATATCCAGGACCTGCTGACCGAGACCGCCGCCGAGCCGCCCTGCGGCCCGGACCTTACCTATG
ACAACGATTTCCAGGCCATGGAAAGCGCTGCCCAGGGCAAGGTAGAACAGCAGTTCGGCGACACCGTCAT
CCCCGCCGAGCCACCGGATTGGCGCGACGTGGAGCGCCAGGCCTCGGCCCTGATGCAGCGCACCAAGGAC
CTGCGCGTGGCCGTGCTACTGTGCCGTGCCTGGACCATCCTGCACGGCCTGCCCGGCACGCTGCAGGGCC
TGCAGCTGTGCGGCGCCCTGCTGGAGCGCCACTGGGAGCATGTCCACCCCCTGCCCGAGGATGGCGACGA
CTACTTCATGCGCATGAACGCCCTGGGCACCCTGTCCGATGTGACAGGCTTTGTGCGTGACCTGCGCAAC
GCCGACTTCCTGCGCGGCGCGCTGGGCCAGATCAGCGTGCGCGACGCCGAACTGATGGCCAAGGGCAACG
TGCCCGAGGACCTGCCGCACCTGACCACCGACGAATTGCGCATGGCCTCGGCACGCGCGCATGCCGAGGG
CCACGAAACCCTGCTGGCCGTCACCCCTGCGCTGCAGGAACTCGACCGGATCCGCGCCTGCTGCGAACAG
CACCTGCCCAGCCACCAGCAGCCCGAGCTCGACGGCCTGCGCCAGCTGCTGCTGGCCCTCAAGCAATGGC
AGCCCCAGTCCACAGGCGATGCCGACACGGACGCTGAAACCGATCCGGCCGCACGAACCGGTGCAGAGGG
CGACACAGAGGGCGGCACGGTGGCCCACCCCGCGTCAGGTTCGGCACCCGCCCCGGCGCGCAACCGCGAA
CAGGCGATTGCCCAGTTGCTGGAAATCGCCGCCTTCGTGGAGCGCACCGAGCCCTCCAACCCCGCCCCCC
TGCTCATCCGCCGCGCCGCCCGCTTCATGCGCATGGGCTTCATGGACATCCTGCGCGAACTGTCCCCCGA
CAGCCTGGCCCAGGTGGAAGTGATCACGGGCGCCCACCTGCAGGAGCAGCAGACATGA