SecReT6
Protein ID: 160899284
SecReT6 ID236
T6SS typei3
Gene symbol-
Locus tagDaci_3850
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T6SS(s) in this replicon]
Location [Strand]4245030..4245572 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDA9BLJ6
KEGG IDdac:Daci_3850
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 7.40E-60, Aligned region: 14..166
Protein Sequence: 180 a.a.     [Download]
>gi|160899284|ref|YP_001564866.1| type VI secretion protein [Delftia acidovorans SPH-1]
MSLTKTGKSGQKFIARNRAPRVQIEYDVEIYGSEKKVQIPFVMGVLADLSGKPVDPLPEIADRKFLEIDI
DNFDARMKSIKPRVAFQVDNTLTGEGKLNIDLSFESMEDFSPAAIARRVGALNSLLEARTQLHNLLSYMD
GKQGAEELIGKVLKDPALLKSLAAAPNITAPQASGPASEA
 
Nucleotide Sequence: 543 bp     [Download]
>gi|160895450|ref|NC_010002.1|:4245030-4245572 Delftia acidovorans SPH-1 chromosome, complete genome
ATGTCGCTCACCAAAACCGGCAAGAGTGGTCAGAAATTCATCGCGCGCAACCGTGCGCCGCGCGTGCAGA
TCGAGTACGACGTCGAGATCTACGGCTCGGAAAAGAAGGTGCAGATCCCCTTCGTGATGGGTGTGCTGGC
CGATCTGTCGGGCAAGCCCGTCGATCCGCTGCCCGAAATCGCCGACCGCAAGTTCCTGGAAATCGACATC
GACAACTTCGATGCGCGCATGAAGTCCATCAAGCCCCGCGTCGCCTTCCAGGTGGACAACACGCTGACGG
GCGAGGGCAAGCTCAACATCGACCTGAGCTTCGAGAGCATGGAGGACTTCTCCCCCGCCGCCATCGCGCG
GCGCGTGGGCGCGCTCAACTCGCTGCTGGAGGCACGCACCCAGCTGCACAACCTGCTGTCCTACATGGAC
GGCAAGCAGGGCGCCGAGGAGCTGATCGGCAAGGTGCTCAAGGACCCTGCGCTGCTCAAGTCGCTGGCCG
CCGCGCCCAACATCACTGCCCCGCAGGCCTCGGGCCCTGCATCCGAGGCTTGA