SecReT6
Protein ID: 160899285
SecReT6 ID236
T6SS typei3
Gene symbol-
Locus tagDaci_3851
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T6SS(s) in this replicon]
Location [Strand]4245601..4247094 [+]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDA9BLJ7
KEGG IDdac:Daci_3851
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.40E-196, Aligned region: 65..490
Protein Sequence: 497 a.a.     [Download]
>gi|160899285|ref|YP_001564867.1| EvpB family type VI secretion protein [Delftia acidovorans SPH-1]
MNTATQLEQSTQALAGSEFGSLLQKEFKPKTDQAREAVEAAVQTLAQQALGSAITLSNDAYQTVQAIIAE
IDRKLSEQINRIIHHDDYQKLEGAWRGLHHLVTNTEVDEMLKIRVMNISKKELHRNMRRFKGVGWDQSPV
FKKVYEEEYGQFGGEPFGCLVGDYHFDHSPPDVELLGEMAKVAAAAHCPFISGAAPAIMQMESWQELANP
RDLTKIFTNTEYAAWRSLRESDDAKYIGLAMPRFLARLPYGARTNPVDEFDFEEETDSGDHGKYCWANSA
YAMAVNINRSFKYYGWCTSIRGVESGGAVDNLPAHTFPTDDGGVDMKCPTEIAISDRREAELAKNGFMPL
VHRKNSDVAAFIGAQSLAKPAEYYDSDATANANLSARLPYMFACCRFAHYLKCIVRDKIGSFRERTDMER
WLNDWIMNYVDGDPANSSQETKARKPLAAAEVQVQEVEGNPGYYTSKFFLRPHYQLEGLTVSLRLVSKLP
SVKQGAK
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|160895450|ref|NC_010002.1|:4245601-4247094 Delftia acidovorans SPH-1 chromosome, complete genome
ATGAATACCGCAACCCAACTCGAACAATCGACCCAGGCGCTGGCCGGCAGCGAATTCGGCAGCCTGCTGC
AAAAGGAATTCAAGCCCAAGACCGACCAGGCCCGCGAAGCCGTGGAAGCGGCCGTGCAGACGCTGGCCCA
GCAGGCCCTGGGCTCGGCGATCACGCTGTCCAACGATGCCTACCAGACGGTGCAGGCCATCATTGCCGAG
ATCGACCGCAAGCTGTCCGAGCAGATCAACCGCATCATCCACCACGACGACTACCAGAAGCTCGAAGGCG
CCTGGCGCGGCCTGCACCACCTGGTGACCAACACCGAGGTGGACGAGATGCTCAAGATCCGCGTCATGAA
CATCTCCAAGAAGGAGCTGCACCGCAACATGCGCCGCTTCAAGGGCGTGGGCTGGGACCAGAGCCCCGTC
TTCAAGAAGGTGTACGAAGAGGAGTACGGCCAGTTCGGCGGCGAGCCCTTCGGCTGCCTGGTGGGCGACT
ACCACTTCGACCACAGCCCGCCGGACGTGGAGCTGCTCGGTGAAATGGCCAAGGTGGCCGCCGCGGCCCA
CTGCCCCTTCATCTCGGGCGCGGCGCCTGCCATCATGCAGATGGAATCCTGGCAGGAGCTGGCCAACCCG
CGCGACCTGACCAAGATCTTCACCAACACCGAGTACGCCGCCTGGCGCAGCCTGCGCGAGTCCGACGACG
CCAAGTACATCGGCCTGGCCATGCCCCGCTTCCTGGCACGCCTGCCCTACGGCGCGCGCACCAACCCAGT
CGATGAATTCGACTTCGAGGAAGAAACCGACAGCGGCGACCACGGCAAGTACTGCTGGGCCAACTCGGCC
TACGCCATGGCGGTCAACATCAACCGCTCGTTCAAGTACTACGGCTGGTGCACCTCCATCCGCGGCGTGG
AATCGGGCGGCGCGGTGGACAACCTGCCGGCGCACACCTTCCCCACCGACGATGGCGGCGTGGACATGAA
GTGCCCCACGGAAATCGCCATCAGCGACCGCCGCGAGGCCGAGCTCGCCAAGAACGGCTTCATGCCCCTG
GTGCACCGCAAGAACTCGGACGTGGCCGCCTTCATCGGCGCCCAGTCGCTGGCCAAGCCCGCCGAGTACT
ACGACTCCGACGCCACGGCCAATGCCAACCTGTCGGCGCGCCTGCCCTACATGTTCGCCTGCTGCCGCTT
CGCGCACTACCTCAAGTGCATCGTGCGCGACAAGATCGGCTCCTTCCGCGAGCGCACCGACATGGAGCGC
TGGCTCAACGACTGGATCATGAACTACGTGGACGGCGACCCGGCCAACTCCTCGCAGGAGACCAAGGCCC
GCAAGCCCCTGGCCGCCGCCGAGGTGCAGGTGCAGGAAGTCGAGGGCAACCCCGGCTACTACACCTCCAA
GTTCTTCCTGCGCCCCCACTACCAGCTGGAAGGCCTGACCGTGTCGCTGCGCCTGGTGTCCAAGCTGCCT
TCGGTCAAGCAGGGCGCGAAGTAA