SecReT6
Protein ID: 160899290
SecReT6 ID236
T6SS typei3
Gene symbol-
Locus tagDaci_3856
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T6SS(s) in this replicon]
Location [Strand]4249644..4250453 [+]
Productvirulence protein SciE type
NoteTagJ
UniProt IDA9BLK2
KEGG IDdac:Daci_3856
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 3.10E-42, Aligned region: 135..263
Protein Sequence: 269 a.a.     [Download]
>gi|160899290|ref|YP_001564872.1| virulence protein SciE type [Delftia acidovorans SPH-1]
MPLPSFTSQLSLDEQLKALKDQIRQAPASVPLRVYYFQLLCVLGEWQKALEQLQLCAQLDPSCEPMARAY
REAIRCEVLRAEVFAGKKKPFLMGEPAQWLACLIDALAHEGAAAQDLRARALDEAPATAGHMGEHRFEWL
ADSDTRLGPVCELLAHGSYYWLPFDAIAQIGFEPVQDLRDLIWLPCEVTLREGGALQGFMPARYPLAPGD
DDAVRMSRRTQWSPLDTGSSDPDESSGHVAGHGQRTWVTDSEDFPMLQVRQLALETATR
 
Nucleotide Sequence: 810 bp     [Download]
>gi|160895450|ref|NC_010002.1|:4249644-4250453 Delftia acidovorans SPH-1 chromosome, complete genome
ATGCCCCTGCCCAGTTTCACCTCACAGCTTTCCCTGGACGAGCAACTCAAGGCCCTGAAGGACCAGATCC
GCCAGGCCCCGGCCTCGGTGCCACTGCGCGTCTACTACTTCCAGCTGCTGTGCGTGCTGGGCGAATGGCA
AAAGGCACTGGAGCAGCTGCAGCTGTGCGCCCAGCTCGACCCGTCGTGCGAGCCCATGGCGCGCGCCTAC
CGCGAGGCCATCCGCTGCGAAGTGCTGCGCGCCGAGGTCTTCGCCGGCAAGAAAAAGCCCTTTCTCATGG
GCGAGCCCGCGCAATGGCTGGCCTGCCTGATCGACGCCCTAGCCCATGAAGGAGCGGCCGCCCAGGACCT
GCGCGCCCGCGCCCTGGACGAGGCGCCCGCCACCGCAGGCCACATGGGCGAGCACCGCTTCGAATGGCTG
GCCGACAGCGATACCCGCCTGGGCCCCGTCTGCGAGCTGCTGGCGCACGGCAGCTACTACTGGCTGCCCT
TCGACGCCATTGCACAGATCGGCTTCGAGCCCGTGCAGGACCTGCGCGACCTGATCTGGCTGCCCTGCGA
GGTCACGCTGCGCGAGGGCGGCGCGCTGCAGGGCTTCATGCCCGCGCGCTATCCGCTGGCGCCCGGCGAT
GACGACGCCGTCCGCATGTCGCGCCGCACGCAGTGGAGCCCGCTGGACACAGGCTCCTCCGATCCTGACG
AATCCTCGGGCCACGTGGCCGGCCACGGCCAGCGCACCTGGGTCACCGACTCCGAGGACTTTCCCATGCT
GCAGGTGCGCCAGCTGGCGCTGGAAACCGCCACGCGATGA