SecReT6
Protein ID: 160899293
SecReT6 ID236
T6SS typei3
Gene symbol-
Locus tagDaci_3859
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T6SS(s) in this replicon]
Location [Strand]4251501..4253375 [+]
Producttype VI secretion protein
NoteTssF
UniProt IDA9BLK5
KEGG IDdac:Daci_3859
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 6.70E-204, Aligned region: 6..622
Protein Sequence: 624 a.a.     [Download]
>gi|160899293|ref|YP_001564875.1| type VI secretion protein [Delftia acidovorans SPH-1]
MNPRLVEYYNRELAYLRELGAEFAAAFPKVAGRLSLHDTDVADPYVERLLEGFSFLSARIQLKMDAEFPR
LSQRMMEMVCPHYLAPTPSMVVVQLKPSAKEGNLVDGFTLPSGSVLRTHKSQEEQTICEFRTGGPLTLWP
LEIRQARLGGPALDLPHALVPQLGEAGGHLRLQLATLDASQCMQLAMDQLWVYIHAGDVVASHLQELIHT
QTLAIVVHHPQDPRQVWDVLQPDALRAEGHDSEQALIPYSHRAFQGHRLLHEYFAFPARQRFFSINGLSR
SMRRIAHDGVGITVLLRRAAPTLEPQIDAAKLLMHCIPAINLFEYTADRLHVASNVHEYHVIPDRTRPLD
FEVYGVQAVTGHHEGKTQDREFAPLYASTHGLHSTEQAYFTTRREPRLFSERSLRSGPRTQYLGSEVFIS
LVDQREAPFSDDLKQLSMHTLCTNRDLPLLMRVNQPGGDFALQESAPVEWARAIAGPSAPIPAVADGGLT
WRLISHLSLNYLAMTDLSDEEGAATLQELLRLYLDLGNHQLAGQIAAIQGMRIEPITRRLPQHRQLVYGR
GVGVHLSVDEPAMAGVSPWPLSNVLERFFARHVGVNSFTELQLHSRQRGPVARWTPRPGQRPGI
 
Nucleotide Sequence: 1875 bp     [Download]
>gi|160895450|ref|NC_010002.1|:4251501-4253375 Delftia acidovorans SPH-1 chromosome, complete genome
ATGAATCCCCGCCTCGTCGAGTACTACAACCGCGAACTGGCCTATCTGCGCGAGCTGGGCGCCGAGTTCG
CCGCCGCCTTCCCCAAGGTGGCGGGCCGCCTTTCCCTGCACGACACCGATGTGGCCGACCCCTATGTGGA
GCGCCTGCTGGAAGGCTTCAGCTTTCTGAGCGCGCGCATCCAGCTGAAGATGGATGCGGAGTTTCCGCGC
CTGTCCCAGCGCATGATGGAGATGGTCTGCCCCCACTACCTGGCGCCCACGCCATCCATGGTGGTGGTCC
AGCTCAAGCCCAGCGCCAAGGAAGGCAACCTCGTGGACGGCTTCACCCTGCCCTCTGGCAGCGTGCTGCG
CACCCACAAGTCACAGGAAGAGCAGACCATCTGCGAATTCCGCACCGGCGGGCCGCTGACGCTGTGGCCG
CTGGAGATACGCCAGGCGCGCCTGGGCGGCCCGGCGCTGGACCTGCCCCATGCCCTGGTACCCCAGCTGG
GCGAGGCCGGCGGCCACCTGCGCCTGCAGCTGGCCACGCTGGACGCCTCGCAGTGCATGCAGCTGGCGAT
GGACCAGCTGTGGGTCTACATCCATGCGGGCGATGTCGTCGCCTCCCACCTGCAGGAACTCATCCACACG
CAGACGCTGGCCATCGTTGTCCACCACCCGCAGGACCCGCGCCAGGTCTGGGACGTGCTGCAGCCCGATG
CACTGCGCGCCGAAGGCCATGACAGCGAGCAGGCGCTGATTCCCTATTCGCACCGCGCCTTCCAGGGCCA
CCGTCTGCTGCACGAGTACTTTGCGTTTCCCGCACGGCAGCGGTTCTTCTCGATCAACGGCCTGTCGCGC
AGCATGCGCCGCATTGCCCATGACGGCGTGGGCATCACCGTGCTGCTGCGCCGCGCCGCGCCCACGCTGG
AGCCGCAGATCGACGCGGCCAAGCTGCTGATGCACTGCATTCCGGCCATCAACCTGTTCGAGTACACGGC
GGACCGCCTGCATGTGGCCTCCAACGTGCACGAGTACCACGTCATTCCCGACCGCACGCGGCCGCTGGAC
TTCGAGGTCTACGGCGTGCAGGCCGTCACCGGCCACCACGAAGGCAAGACCCAGGACCGCGAATTCGCGC
CGCTGTACGCATCCACGCACGGCCTGCACTCCACCGAGCAGGCCTACTTCACCACGCGGCGCGAGCCCCG
GCTGTTTTCCGAGCGCAGCCTGCGCAGCGGCCCGCGCACGCAGTACCTGGGCTCGGAAGTCTTCATCTCC
CTGGTGGACCAGCGCGAGGCCCCGTTCTCCGACGACCTCAAGCAGCTGTCCATGCACACCCTGTGCACCA
ACCGCGACCTGCCCCTGCTCATGCGCGTCAACCAGCCGGGCGGCGACTTTGCGCTGCAGGAATCGGCGCC
CGTGGAATGGGCCCGCGCCATCGCCGGCCCCAGCGCGCCCATCCCCGCCGTGGCCGACGGAGGCCTGACC
TGGCGATTGATCTCCCACCTGAGCCTGAACTACCTGGCCATGACCGATCTGTCCGACGAGGAAGGCGCGG
CCACGCTGCAGGAGCTGCTGCGCCTGTACCTGGACCTGGGCAACCACCAGCTGGCCGGGCAGATCGCCGC
CATCCAGGGCATGCGCATCGAACCCATCACGCGCCGCCTGCCCCAGCACCGCCAGCTGGTCTACGGCCGC
GGCGTGGGCGTACACCTGAGCGTGGACGAGCCGGCCATGGCTGGCGTCAGCCCCTGGCCCCTGTCCAATG
TGCTGGAGCGATTCTTCGCCCGCCATGTGGGCGTCAACAGCTTCACCGAGCTGCAGCTGCACTCGCGCCA
GCGCGGTCCCGTCGCGCGCTGGACTCCGCGCCCCGGACAAAGGCCCGGCATATGA