SecReT6
Protein ID: 160899294
SecReT6 ID236
T6SS typei3
Gene symbol-
Locus tagDaci_3860
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T6SS(s) in this replicon]
Location [Strand]4253462..4254562 [+]
Producttype VI secretion protein
NoteTssG
UniProt IDA9BLK6
KEGG IDdac:Daci_3860
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 7.80E-112, Aligned region: 20..323
Protein Sequence: 366 a.a.     [Download]
>gi|160899294|ref|YP_001564876.1| type VI secretion protein [Delftia acidovorans SPH-1]
MQATGPEDARARLFWQRLSAKPYQFDLMHSLRYLQARHPALPRLGQATRPKDEPLRLGQDPSLAFAPATI
AEILPSRAGEPERMTVWNFGLYGPNGPLPTHITEYVRERLRQHDDATLARFSDIFHHRMLLLLFRAWSDA
QPTASLDRPGEDPFGRYIDSFIGAGLPSQRARDDVPDHAKRFMAGHLTRWTRNPEGLCQALSHYFQIPVK
LEENCLHHLELEPEQQTRLQGRPCNSRLGVDAVVGSRVPDAQSKFRLVLGPLGLEQYRQLLPQAALFQTL
VDWVRNYLGIEFAWDYVLVLRRQEVPAARLGSSTQLGWTTWLTHAEPAQDARDFRLDPEAWLRQRRQPVR
GRRPGPSPRTTESPNH
 
Nucleotide Sequence: 1101 bp     [Download]
>gi|160895450|ref|NC_010002.1|:4253462-4254562 Delftia acidovorans SPH-1 chromosome, complete genome
GTGCAGGCCACCGGGCCCGAAGACGCCCGGGCGCGCCTGTTCTGGCAGCGCCTGAGCGCCAAGCCCTACC
AGTTCGACCTGATGCACAGCCTGCGCTACCTGCAGGCACGCCATCCCGCGCTGCCGCGCCTGGGCCAGGC
CACGCGCCCCAAGGACGAGCCGCTGCGCCTGGGCCAGGACCCGTCGCTGGCCTTCGCCCCCGCCACCATT
GCCGAAATCCTGCCCTCGCGCGCCGGCGAGCCCGAGCGCATGACGGTCTGGAACTTCGGCCTCTACGGCC
CCAACGGCCCGCTGCCCACGCACATCACCGAATACGTGCGCGAGCGCCTGCGCCAGCATGACGACGCCAC
GCTGGCACGCTTTTCCGACATCTTTCACCACCGCATGCTGCTGCTGCTGTTCCGCGCCTGGTCGGACGCA
CAGCCCACCGCATCGCTGGACCGCCCGGGCGAAGACCCCTTTGGCCGCTACATAGACAGTTTCATAGGCG
CCGGCCTGCCCAGCCAGCGCGCGCGCGACGACGTGCCAGACCACGCCAAGCGCTTCATGGCCGGCCATCT
GACCCGCTGGACGCGCAACCCCGAAGGACTGTGCCAGGCCCTGTCGCACTACTTCCAGATTCCGGTGAAG
CTGGAAGAAAACTGCCTGCACCACCTGGAGCTGGAGCCCGAGCAGCAGACCCGGCTGCAGGGCCGCCCCT
GCAACTCGCGTCTGGGCGTGGACGCCGTCGTGGGCTCGCGCGTGCCCGATGCGCAAAGCAAGTTCCGCCT
GGTGCTCGGCCCGCTGGGTCTGGAGCAATACCGGCAGCTGCTGCCCCAGGCCGCACTGTTCCAGACCCTG
GTGGACTGGGTTCGCAACTACCTGGGCATCGAATTCGCCTGGGACTACGTGCTGGTGCTGCGCCGCCAGG
AAGTACCTGCAGCCCGGCTGGGCAGCAGCACCCAGCTGGGCTGGACCACCTGGCTCACCCACGCCGAGCC
CGCCCAGGACGCGCGCGACTTCCGCCTGGACCCCGAAGCCTGGCTGCGCCAGCGCCGCCAGCCCGTGCGC
GGCCGGCGCCCGGGCCCCAGCCCTCGAACCACTGAATCACCGAACCACTGA