SecReT6
Protein ID: 160899298
SecReT6 ID236
T6SS typei3
Gene symbol-
Locus tagDaci_3864
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T6SS(s) in this replicon]
Location [Strand]4256651..4259437 [+]
Producttype VI secretion ATPase
NoteTssH
UniProt IDA9BLL0
KEGG IDdac:Daci_3864
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 2.80E-40, Aligned region: 248..269
AAA_2 [PF07724], Evalue: 2.80E-40, Aligned region: 653..820
AAA [PF00004], Evalue: 6.90E-20, Aligned region: 248..361
AAA [PF00004], Evalue: 6.90E-20, Aligned region: 659..743
ClpB_D2-small [PF10431], Evalue: 1.00E-13, Aligned region: 827..900
AAA_5 [PF07728], Evalue: 1.60E-13, Aligned region: 248..270
AAA_5 [PF07728], Evalue: 1.60E-13, Aligned region: 658..777
AAA_16 [PF13191], Evalue: 6.20E-08, Aligned region: 95..95
AAA_16 [PF13191], Evalue: 6.20E-08, Aligned region: 225..270
AAA_16 [PF13191], Evalue: 6.20E-08, Aligned region: 292..327
AAA_16 [PF13191], Evalue: 6.20E-08, Aligned region: 650..703
AAA_16 [PF13191], Evalue: 6.20E-08, Aligned region: 723..745
AAA_16 [PF13191], Evalue: 6.20E-08, Aligned region: 800..846
AAA_25 [PF13481], Evalue: 3.50E-07, Aligned region: 246..320
AAA_25 [PF13481], Evalue: 3.50E-07, Aligned region: 656..685
AAA_22 [PF13401], Evalue: 1.00E-06, Aligned region: 77..113
AAA_22 [PF13401], Evalue: 1.00E-06, Aligned region: 248..328
AAA_22 [PF13401], Evalue: 1.00E-06, Aligned region: 656..681
AAA_22 [PF13401], Evalue: 1.00E-06, Aligned region: 720..746
Sigma54_activat [PF00158], Evalue: 1.30E-06, Aligned region: 244..266
Sigma54_activat [PF00158], Evalue: 1.30E-06, Aligned region: 658..774
NACHT [PF05729], Evalue: 1.40E-05, Aligned region: 248..274
NACHT [PF05729], Evalue: 1.40E-05, Aligned region: 311..350
NACHT [PF05729], Evalue: 1.40E-05, Aligned region: 658..686
AAA_19 [PF13245], Evalue: 4.40E-05, Aligned region: 245..271
AAA_19 [PF13245], Evalue: 4.40E-05, Aligned region: 449..464
AAA_19 [PF13245], Evalue: 4.40E-05, Aligned region: 656..680
Zeta_toxin [PF06414], Evalue: 4.50E-05, Aligned region: 248..270
Zeta_toxin [PF06414], Evalue: 4.50E-05, Aligned region: 416..472
Zeta_toxin [PF06414], Evalue: 4.50E-05, Aligned region: 657..698
AAA_14 [PF13173], Evalue: 0.00013, Aligned region: 250..328
AAA_14 [PF13173], Evalue: 0.00013, Aligned region: 657..775
AAA_17 [PF13207], Evalue: 0.00018, Aligned region: 248..289
AAA_17 [PF13207], Evalue: 0.00018, Aligned region: 658..694
IstB_IS21 [PF01695], Evalue: 0.0002, Aligned region: 239..267
IstB_IS21 [PF01695], Evalue: 0.0002, Aligned region: 658..678
IstB_IS21 [PF01695], Evalue: 0.0002, Aligned region: 768..792
AAA_18 [PF13238], Evalue: 0.0012, Aligned region: 248..268
AAA_18 [PF13238], Evalue: 0.0012, Aligned region: 659..687
AAA_18 [PF13238], Evalue: 0.0012, Aligned region: 850..890
AAA_29 [PF13555], Evalue: 0.0048, Aligned region: 240..264
AAA_29 [PF13555], Evalue: 0.0048, Aligned region: 656..670
Clp_N [PF02861], Evalue: 0.005, Aligned region: 44..90
Clp_N [PF02861], Evalue: 0.005, Aligned region: 122..143
RuvB_N [PF05496], Evalue: 0.0074, Aligned region: 248..263
RuvB_N [PF05496], Evalue: 0.0074, Aligned region: 317..328
RuvB_N [PF05496], Evalue: 0.0074, Aligned region: 625..679
RuvB_N [PF05496], Evalue: 0.0074, Aligned region: 727..751
RNA_helicase [PF00910], Evalue: 0.0084, Aligned region: 249..269
RNA_helicase [PF00910], Evalue: 0.0084, Aligned region: 659..680
RNA_helicase [PF00910], Evalue: 0.0084, Aligned region: 757..777
Protein Sequence: 928 a.a.     [Download]
>gi|160899298|ref|YP_001564880.1| type VI secretion ATPase [Delftia acidovorans SPH-1]
MPGPHSSTLFPHPRPMTEISRQSLFGKLNPLLFKSLEGATVFCKLRGNPYVELVHWLHQLLQENDCDLIR
ILRHFDIASDRLAADVLRRLDQLPRGATSISDFSEHIETAIERGWVYATLMFNDSQIRSAYLLSGMVRTR
SLANELRSISREFDKISEPALSDAFARLLPDSPEARMRAADGSGLEGTPGEASQATGAAPGQGGALQQYT
VDLTARAKAGELDPVTGRDDEVRQMVDILLRRRQNNPILVGEAGVGKTAVVEGLALRIAQGDVPPPLQGV
ELRVLDVGLLQAGASMKGEFENRLRGLLDAVQSSTTPIVLFIDEVHTLVGAGGQAGTGDAANLLKPALAR
GTLRTIGATTWAEYKKYIEKDPALTRRFQLVQVHEPDEPRAVDMLRGVAAKLENHHQVRIAADAVAAAVS
LSHRYIPSRQLPDKAVSLLDTACSRVAMALHATPAQLEAVQRRIEALGVEQEVLLREAALGLPTAERLQA
LETDLASLRERQATLAERFGQESALARRILETEAALMGLKPPVFSTGAATDPSAAAPETAAEATATEPAE
PPSVATLEALRRQLAELQGDAPLLQPVVDAGVVAAVVAEWTGIPVGRMVRDEVQSVLSLADTLEKRVIGQ
RHGLEAITRRIQTSRARLDDPGKPIGVFLLAGPSGVGKTETALSLAEALYGGEQNLITINMSEFQEAHTV
STLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEIEKAHSDVHEMFFQVFDKGWMEDGEGRYIDFKNTV
IILTSNVGSDLIANMCRDPDLAPTPEGLAQAVRQPLLQTFPAALLGRLTVVPYYPISDAMLEQIIRLQML
RIQRRIEERHGAQFSFDEAAVDLVRRRCSEVESGARMVDGILTQNLLPRMATHFLQATVEGQELQSLHAG
ASGDDFTLDVRTRAAEPA
 
Nucleotide Sequence: 2787 bp     [Download]
>gi|160895450|ref|NC_010002.1|:4256651-4259437 Delftia acidovorans SPH-1 chromosome, complete genome
ATGCCCGGCCCCCATTCATCCACTCTTTTTCCGCACCCAAGACCCATGACAGAAATCAGCCGCCAATCCC
TCTTCGGCAAGCTCAACCCGCTGCTGTTCAAGTCGCTGGAAGGCGCCACCGTGTTCTGCAAGCTGCGCGG
CAATCCCTATGTGGAGCTGGTGCACTGGCTGCACCAGCTGCTGCAGGAAAACGATTGCGACCTGATCCGC
ATCCTGCGCCACTTCGACATCGCCTCCGACCGCCTGGCCGCCGATGTGCTGCGCCGTCTGGACCAGTTGC
CGCGCGGCGCCACCTCGATCAGCGACTTCTCCGAGCACATAGAGACCGCCATCGAGCGCGGCTGGGTCTA
TGCCACGCTGATGTTCAACGACAGCCAGATCCGCAGCGCCTATCTGCTGTCGGGCATGGTGCGCACGCGC
TCGCTGGCCAATGAGCTGCGCTCCATCTCGCGCGAATTCGACAAGATCTCCGAGCCCGCGCTCAGCGATG
CCTTCGCCCGCCTGCTGCCCGACTCGCCCGAGGCTCGCATGCGCGCGGCCGATGGCAGCGGGCTGGAAGG
CACGCCGGGCGAAGCCAGCCAGGCCACGGGCGCCGCGCCCGGCCAGGGCGGTGCGCTGCAGCAGTACACG
GTGGACCTGACGGCCCGCGCCAAGGCCGGCGAGCTGGACCCGGTCACGGGCCGCGACGACGAAGTGCGCC
AGATGGTGGACATCCTGCTGCGCCGCCGCCAGAACAACCCCATCCTGGTGGGTGAGGCCGGCGTGGGCAA
GACCGCCGTGGTCGAAGGCCTGGCCCTGCGCATCGCCCAGGGCGACGTGCCGCCGCCGCTGCAGGGCGTG
GAGCTGCGCGTGCTGGACGTGGGCCTGCTGCAGGCCGGCGCCAGCATGAAGGGCGAGTTCGAGAACCGCC
TGCGCGGCCTGCTGGACGCCGTGCAGTCCAGCACCACGCCCATCGTGCTCTTCATCGACGAAGTCCACAC
CCTGGTGGGCGCGGGCGGCCAGGCCGGTACGGGCGATGCCGCCAACCTGCTCAAGCCTGCCCTGGCGCGC
GGCACGCTGCGCACCATCGGCGCCACCACCTGGGCCGAGTACAAGAAATACATCGAAAAAGACCCGGCCC
TGACCCGCCGCTTCCAGCTCGTTCAGGTGCACGAGCCCGACGAGCCCCGCGCCGTGGACATGCTGCGCGG
CGTGGCCGCCAAGCTGGAAAACCATCACCAGGTGCGCATTGCGGCCGACGCGGTGGCCGCGGCCGTCAGC
CTGTCGCACCGCTACATTCCCTCGCGCCAGTTGCCCGACAAGGCCGTCAGCCTGCTGGACACGGCCTGCT
CGCGCGTGGCCATGGCCCTGCATGCCACGCCCGCCCAGCTTGAAGCCGTGCAGCGCCGCATCGAGGCCCT
GGGCGTGGAGCAGGAAGTGCTGCTGCGCGAGGCCGCCCTCGGCCTGCCCACGGCCGAGCGCCTGCAGGCG
CTGGAAACCGACCTGGCCAGCCTGCGCGAGCGCCAGGCCACGCTGGCCGAGCGCTTCGGCCAGGAAAGCG
CGCTGGCCCGCCGCATCCTGGAAACCGAGGCCGCCCTCATGGGCCTGAAGCCACCGGTCTTCTCCACCGG
CGCCGCCACAGACCCGTCCGCTGCGGCGCCGGAGACGGCCGCCGAAGCCACCGCAACCGAACCTGCCGAG
CCCCCCAGCGTGGCCACGCTGGAAGCGCTGCGCCGCCAGCTCGCCGAGCTGCAGGGCGATGCCCCGCTGC
TGCAGCCCGTGGTCGATGCCGGCGTGGTCGCCGCCGTGGTGGCCGAGTGGACCGGCATTCCCGTGGGCCG
CATGGTGCGCGACGAGGTGCAGTCCGTGCTCTCGCTGGCCGACACGCTGGAGAAGCGCGTCATCGGCCAG
CGCCACGGCCTGGAGGCCATCACGCGCCGCATCCAGACCTCGCGCGCGCGGCTGGACGATCCGGGCAAGC
CCATCGGCGTGTTCCTGCTCGCCGGCCCCTCGGGCGTGGGCAAGACAGAAACCGCCCTCTCCCTGGCCGA
AGCCCTGTATGGCGGCGAGCAAAACCTCATCACCATCAACATGAGCGAGTTCCAGGAGGCGCACACCGTC
TCCACCCTCAAGGGCGCGCCACCGGGCTACGTGGGCTACGGCGAAGGCGGCGTGCTCACCGAGGCCGTGC
GCCGCCGCCCCTACAGCGTGGTCCTGCTCGACGAAATCGAAAAGGCCCACTCCGACGTGCACGAGATGTT
CTTCCAGGTCTTCGACAAAGGCTGGATGGAAGACGGCGAGGGCCGCTACATCGACTTCAAGAACACCGTC
ATCATCCTGACCTCCAACGTGGGCTCGGACCTGATCGCCAACATGTGCCGCGACCCGGACCTGGCGCCCA
CGCCGGAAGGCCTGGCCCAGGCCGTGCGCCAGCCGCTGCTGCAGACCTTCCCCGCCGCGCTGCTGGGCCG
CCTGACGGTGGTGCCCTACTACCCCATCTCCGACGCCATGCTGGAGCAGATCATCCGGCTGCAGATGCTG
CGCATACAGCGGCGCATCGAGGAGCGCCACGGCGCGCAGTTCAGCTTCGACGAAGCCGCCGTGGACCTGG
TGCGCCGCCGCTGCAGCGAGGTCGAGTCCGGCGCGCGCATGGTGGACGGCATCCTCACCCAGAACCTGCT
GCCGCGCATGGCAACCCACTTCCTGCAGGCCACCGTGGAAGGCCAGGAACTGCAAAGCCTGCACGCCGGC
GCCAGCGGCGACGACTTCACGCTGGACGTGCGCACCCGCGCTGCGGAGCCCGCATGA