SecReT6
Protein ID: 160899302
SecReT6 ID236
T6SS typei3
Gene symbol-
Locus tagDaci_3868
StrainDelftia acidovorans SPH-1
Repliconchromosome [GenBank: NC_010002] [Browse all T6SS(s) in this replicon]
Location [Strand]4263992..4266184 [+]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDA9BLL4
KEGG IDdac:Daci_3868
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.00E-84, Aligned region: 23..326
Phage_base_V [PF04717], Evalue: 1.30E-27, Aligned region: 91..103
Phage_base_V [PF04717], Evalue: 1.30E-27, Aligned region: 366..459
Phage_base_V [PF04717], Evalue: 1.30E-27, Aligned region: 663..703
Gp5_C [PF06715], Evalue: 0.0002, Aligned region: 519..538
Gp5_C [PF06715], Evalue: 0.0002, Aligned region: 543..556
Gp5_C [PF06715], Evalue: 0.0002, Aligned region: 551..573
Gp5_C [PF06715], Evalue: 0.0002, Aligned region: 566..589
Gp5_C [PF06715], Evalue: 0.0002, Aligned region: 575..597
Gp5_C [PF06715], Evalue: 0.0002, Aligned region: 603..613
Gp5_C [PF06715], Evalue: 0.0002, Aligned region: 599..619
Gp5_C [PF06715], Evalue: 0.0002, Aligned region: 636..653
Gp5_C [PF06715], Evalue: 0.0002, Aligned region: 663..677
Gp5_C [PF06715], Evalue: 0.0002, Aligned region: 697..711
Protein Sequence: 730 a.a.     [Download]
>gi|160899302|ref|YP_001564884.1| ImpA family type VI secretion-associated protein [Delftia acidovorans SPH-1]
MTRRVTINTPLADQLQLRRLQGREEISHLFALEIDLLSESDSIDPKALLGKGATVVVETQDGGKRYIDGL
VTAFGMRGQDEHRNFLYRARLSPWLWLATRRSDFRIFQNKTVPDIINEVLGIYGHPMQQRLTRSYRTWEY
CVQYNETDFQFVSRLMEHEGICYYHQHSAGQHVLTLGDDIVASHDPLQGGAVIPFHPPGKAAVAREECIH
AWELHQRVKPGRHYNDDYDFKKPRAELSNMRRNPPGHAHDAYEIYEWPGGYTETGDGEDYIRVRLQQSLT
RQSTVQGSSNHRAMAPGYTFTLDNYPRGDQNQAYLVTAVDYAFEENPRVSDGGSGEGSTQKFVLQAQPTS
LPFKPQRITAKPRTTGPQTAVVVGPAGEEIWCDQYGRVKVQFHWDRIGGMNENSSCWMRVATSWAGPGFG
AVHIPRIGMEVIVDFLNGDPDYPIVMGCVYNASNMPPWALPANATQSGIKTRSSKGGAPGAGMKNGQGDA
NAIRFEDKAGAEQLWLHAQKDQLTEVENDEDKWVGNDRRKTIDRDETNVIHRDRTETVDRDETITVHNNR
TERVDHNEKISIGDNRNEDVGIDENISIGKNRSKTIGRNEKDKIGNNWSIKVGSFKTETIGLAYMQNVGL
AKMVNIGAAYNVNVGAAMVVNVGLSQSTTVLVDRSVRVQGNQQTTVGKRYAIQAGDELLITVGAASLVMK
SDGTITINGKNIDVVGSKHIGLDSKRIDLN
 
Nucleotide Sequence: 2193 bp     [Download]
>gi|160895450|ref|NC_010002.1|:4263992-4266184 Delftia acidovorans SPH-1 chromosome, complete genome
ATGACACGCAGAGTCACCATCAACACTCCCCTGGCAGACCAGCTGCAGCTGCGCCGGCTGCAGGGTCGCG
AGGAAATCAGCCATCTGTTCGCCCTGGAGATCGACCTGCTCAGCGAAAGCGACAGCATCGATCCCAAGGC
CCTGCTGGGCAAGGGCGCCACCGTGGTGGTGGAGACCCAGGACGGCGGCAAACGCTACATCGATGGCCTG
GTCACGGCCTTCGGCATGCGCGGCCAGGACGAGCACCGCAACTTCCTGTACCGCGCGCGCCTGTCGCCCT
GGCTGTGGCTGGCCACGCGCCGCAGCGACTTTCGCATCTTCCAGAACAAGACCGTGCCGGACATCATCAA
CGAGGTCCTGGGCATCTACGGCCACCCCATGCAGCAGCGCCTGACGCGCTCCTACCGCACCTGGGAGTAC
TGCGTGCAGTACAACGAGACGGACTTCCAGTTCGTCTCGCGCCTCATGGAGCACGAGGGCATCTGCTACT
ACCACCAGCACAGCGCGGGCCAGCACGTGCTGACATTGGGCGACGACATCGTCGCCTCGCACGACCCGCT
GCAGGGCGGCGCCGTCATCCCCTTCCACCCGCCGGGCAAGGCAGCCGTGGCGCGCGAGGAATGCATACAC
GCCTGGGAACTGCACCAGCGCGTCAAGCCCGGCCGGCACTACAACGACGACTACGACTTCAAGAAGCCCC
GCGCCGAGCTGTCCAACATGCGCCGCAACCCGCCCGGCCATGCGCACGACGCCTACGAGATCTACGAATG
GCCGGGCGGCTACACCGAAACCGGCGACGGCGAGGACTACATCCGCGTGCGCCTGCAGCAAAGCCTCACG
CGCCAGAGCACGGTGCAGGGCAGCTCCAACCACCGCGCCATGGCGCCGGGCTACACCTTCACGCTGGACA
ACTACCCGCGCGGCGACCAGAACCAGGCCTACCTGGTCACGGCCGTGGACTACGCCTTCGAAGAAAACCC
GCGCGTCAGCGACGGCGGCAGCGGCGAGGGCTCGACACAGAAATTCGTGCTCCAGGCCCAGCCCACCAGC
CTGCCCTTCAAGCCCCAGCGCATTACCGCCAAACCACGCACCACGGGCCCGCAGACCGCCGTCGTCGTGG
GCCCCGCAGGCGAAGAGATCTGGTGCGACCAGTACGGCCGCGTCAAGGTGCAGTTCCACTGGGACCGCAT
CGGCGGCATGAACGAGAACTCCAGCTGCTGGATGCGCGTGGCCACCAGCTGGGCCGGGCCGGGCTTTGGC
GCGGTGCACATCCCGCGCATCGGCATGGAAGTCATCGTGGACTTCCTCAACGGCGACCCGGACTACCCCA
TCGTCATGGGCTGCGTCTACAACGCCTCCAACATGCCGCCCTGGGCGCTGCCGGCCAACGCCACGCAATC
GGGCATCAAGACCAGATCCAGCAAGGGCGGCGCACCGGGCGCGGGCATGAAGAACGGCCAGGGCGACGCC
AACGCCATCCGCTTCGAGGACAAGGCGGGCGCCGAACAGCTGTGGCTGCATGCGCAAAAGGACCAGCTCA
CCGAAGTCGAGAACGACGAGGACAAATGGGTGGGCAACGACCGGCGCAAGACCATCGACCGGGATGAAAC
TAACGTCATCCACCGCGACCGCACGGAGACCGTGGACCGCGACGAAACCATCACCGTGCACAACAACCGC
ACGGAGCGGGTGGACCACAACGAGAAGATCAGCATCGGCGACAACCGCAACGAAGACGTTGGCATCGACG
AGAACATCTCCATCGGCAAGAACCGCAGCAAGACCATAGGCCGCAACGAGAAGGACAAGATCGGCAACAA
CTGGTCGATCAAGGTGGGCAGCTTCAAGACAGAGACCATCGGACTGGCCTACATGCAGAACGTGGGCCTG
GCCAAGATGGTGAACATCGGCGCCGCCTACAACGTCAATGTGGGCGCGGCCATGGTGGTGAATGTGGGGC
TGAGCCAGAGCACGACGGTGCTGGTGGACCGTTCCGTCAGGGTCCAGGGCAACCAGCAGACCACGGTAGG
AAAGCGCTACGCCATTCAGGCCGGCGACGAGCTCTTAATCACCGTGGGCGCTGCCAGCTTGGTAATGAAA
AGCGACGGCACGATCACCATCAATGGCAAGAACATCGACGTGGTCGGCAGCAAGCACATCGGCCTCGACT
CCAAGCGTATTGACCTGAACTGA