SecReT6
Protein ID: 161504486
SecReT6 ID237
T6SS typei2
Gene symbol-
Locus tagSARI_02599
StrainSalmonella enterica subsp. arizonae serovar 62:z4,z23:- str. RSK2980
Repliconchromosome [GenBank: NC_010067] [Browse all T6SS(s) in this replicon]
Location [Strand]2516748..2519045 [-]
Producthypothetical protein
NoteTssI
UniProt IDA9MMY1
KEGG IDses:SARI_02599
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 3.50E-60, Aligned region: 33..339
T6SS_Vgr [PF13296], Evalue: 2.00E-33, Aligned region: 471..576
T6SS_Vgr [PF13296], Evalue: 2.00E-33, Aligned region: 610..628
DUF2345 [PF10106], Evalue: 1.20E-28, Aligned region: 603..730
Phage_base_V [PF04717], Evalue: 2.10E-13, Aligned region: 113..125
Phage_base_V [PF04717], Evalue: 2.10E-13, Aligned region: 390..466
Phage_base_V [PF04717], Evalue: 2.10E-13, Aligned region: 734..756
Protein Sequence: 765 a.a.     [Download]
>gi|161504486|ref|YP_001571598.1| hypothetical protein SARI_02599 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
MDNWLALFDGQTRYFLDINDSTVKPDVLRFRGREALSEPFKWDIEFTTPQANISPEEVLMKYASFRMRSG
KNVHGVVTRLEWLSTTRDQSLYRLTLSSRLALLEHTRQCAVFQSQSVPEVVEQVLRKHGLEGPDFEFRLE
RTYPPRELITQWRETDLQFIQRILSEVGIYWRTVMDDVRGLDTYILADSQLNYRFDVRLPYREPSGLFDG
AAESVWDVRTWHTIATGTVMTRDYNYRTASTPMDAAVSVRNDAVTTGEHYRYAVPYREAGDDSSPEPETE
SGAFYARIHHERELNKSSRIHLFSNAAHLTPGQVLEPQGDVITALQEGVFLTLVTFRGARDSRLHVSVWG
QPYTERYCFRPVEIPRPVIPGTLPARIESREKNDIYAHLDEQGRYRVKLDFDREGTESGYGYLWLRMAKP
YAGDTLGWHTPLTDGTEVAIAYSNGDIDLPYIAYALHDSEHPDHVTRDNPTRNVLRTPANNKLRMEDKRG
EEHVKLATEYGKTQLNSGHLVNSKGETRGRGAELRTDEWGTLRAGKGLFVSADAQAKAQGEVLDMSAALE
EIDRLNQQLQQLEIAAEQAQALKADVDSQIRMFEQRLKPLSEALLMYAPEGMALTSGEHLQMTATKNVAM
NAGGNFSAGVMGNLTALAGEKLGLFARTGQLSLKVSEGPVEVQAQNASMRLFAEKKLTLSSASDISFAGK
KRITLVGGGSYLRLEAGKVEYGTMATYMRKVKRTMAAGANSIDVDIPSIAGEVSILSFTKKILFS
 
Nucleotide Sequence: 2298 bp     [Download]
>ref|NC_010067.1|:c2519045-2516748 hypothetical protein SARI_02599 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
ATGGATAACTGGCTGGCGCTTTTTGACGGACAGACCCGTTACTTTCTGGATATTAATGACAGTACAGTGA
AGCCGGATGTTTTGCGCTTTCGTGGCAGGGAAGCGCTGAGCGAGCCGTTTAAGTGGGATATTGAGTTCAC
TACTCCGCAGGCGAACATTTCCCCGGAGGAGGTGCTGATGAAATATGCCTCCTTTCGTATGCGCAGCGGC
AAAAACGTTCACGGTGTTGTCACCCGCCTGGAGTGGCTTTCCACTACCCGGGATCAGTCTCTCTACCGGC
TCACGCTCAGTTCCCGGCTGGCGCTGCTGGAGCACACCCGCCAGTGCGCCGTATTTCAGAGCCAGTCGGT
GCCGGAGGTGGTGGAGCAGGTACTGCGCAAACACGGGCTGGAGGGACCTGATTTTGAATTCAGGCTGGAG
CGCACCTACCCGCCGCGTGAACTTATCACCCAGTGGCGGGAAACGGATTTACAGTTCATCCAGCGCATTC
TGTCCGAGGTGGGGATTTACTGGCGTACGGTGATGGACGACGTGCGCGGTCTGGATACGTACATACTGGC
CGACAGCCAGCTTAACTACCGGTTTGATGTGCGTCTGCCGTACCGCGAGCCGTCGGGCCTGTTCGACGGC
GCGGCAGAGTCGGTCTGGGATGTGCGGACCTGGCACACCATAGCCACCGGCACCGTCATGACGCGGGATT
ACAACTACCGGACAGCCAGCACGCCGATGGATGCGGCGGTCAGCGTACGTAATGATGCGGTCACCACCGG
AGAGCATTACCGCTACGCCGTGCCTTACCGTGAGGCGGGTGATGACAGCAGCCCGGAGCCGGAAACCGAA
TCCGGGGCGTTCTATGCGCGCATCCATCACGAGCGGGAGCTGAATAAATCGTCCCGCATTCATCTGTTCA
GCAATGCTGCACACCTCACTCCCGGGCAGGTGCTGGAGCCGCAGGGCGACGTCATTACGGCCCTGCAAGA
AGGCGTGTTCCTCACGCTGGTGACCTTCCGTGGCGCCCGTGATTCCCGTCTGCATGTGTCAGTCTGGGGC
CAGCCTTACACCGAACGTTACTGCTTCCGTCCGGTAGAGATCCCTCGCCCGGTCATCCCGGGTACGCTTC
CGGCCCGGATAGAGAGCCGGGAGAAGAACGACATTTACGCTCACCTGGACGAGCAGGGGCGCTATCGGGT
GAAACTGGACTTCGACCGGGAGGGGACGGAATCCGGTTACGGTTACCTGTGGCTGCGGATGGCGAAGCCG
TACGCCGGTGACACGCTGGGCTGGCATACGCCGCTCACCGACGGGACCGAAGTGGCGATTGCGTACAGCA
ACGGTGATATTGACCTGCCGTACATCGCGTATGCGCTGCACGACTCGGAGCACCCGGACCACGTCACCCG
CGACAACCCTACCCGTAACGTGTTACGCACGCCCGCGAACAATAAGCTGCGGATGGAAGACAAGCGCGGT
GAGGAGCACGTCAAGCTCGCCACGGAATACGGCAAGACGCAGCTCAACAGCGGGCACCTGGTGAACAGCA
AGGGAGAGACTCGCGGCAGAGGCGCAGAGCTGCGCACCGACGAGTGGGGAACACTGCGAGCCGGAAAGGG
GCTGTTTGTCAGCGCCGACGCGCAGGCGAAGGCACAGGGCGAGGTGCTGGATATGAGCGCCGCGCTGGAG
GAAATCGACAGGCTCAACCAGCAGTTGCAGCAGCTGGAAATCGCGGCAGAGCAGGCGCAGGCGCTGAAGG
CGGATGTGGACAGCCAGATACGGATGTTTGAGCAGAGGCTGAAGCCGCTCAGTGAGGCGCTGCTGATGTA
CGCCCCGGAAGGGATGGCGCTGACCAGCGGGGAGCATCTGCAGATGACGGCCACGAAAAACGTTGCCATG
AATGCCGGAGGCAATTTCAGTGCTGGCGTGATGGGCAATCTGACCGCGCTGGCCGGGGAGAAACTGGGGC
TGTTTGCGCGGACGGGGCAACTGAGTCTCAAAGTCAGCGAAGGTCCGGTGGAGGTGCAGGCGCAGAATGC
CAGTATGCGGTTGTTTGCGGAGAAGAAGCTGACGCTGAGTTCGGCAAGTGACATCTCGTTTGCCGGGAAG
AAACGCATCACGCTGGTCGGTGGCGGGAGTTATCTGCGGCTGGAGGCGGGAAAGGTGGAGTACGGTACGA
TGGCGACGTATATGCGGAAGGTGAAAAGAACGATGGCGGCGGGAGCAAATTCAATTGATGTTGATATTCC
GTCTATTGCAGGTGAGGTATCAATTTTATCTTTCACAAAAAAAATTCTGTTCTCATAA