SecReT6
Protein ID: 161504487
SecReT6 ID237
T6SS typei2
Gene symbol-
Locus tagSARI_02600
StrainSalmonella enterica subsp. arizonae serovar 62:z4,z23:- str. RSK2980
Repliconchromosome [GenBank: NC_010067] [Browse all T6SS(s) in this replicon]
Location [Strand]2519050..2519373 [-]
Producthypothetical protein
NoteTssJ
UniProt IDA9MMY2
KEGG IDses:SARI_02600
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 3.70E-26, Aligned region: 1..97
Protein Sequence: 107 a.a.     [Download]
>gi|161504487|ref|YP_001571599.1| hypothetical protein SARI_02600 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
MVRVYQLRDSKAIDAADYQTLLRKADTVLNDDVLASKELLVMPNGSVTLNMPMDEDAQFVAVVGLFNRPD
QKDNRWRLVLTRDDLDPDKPRIIELGDGWLSLVPVKE
 
Nucleotide Sequence: 324 bp     [Download]
>ref|NC_010067.1|:c2519373-2519050 hypothetical protein SARI_02600 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
ATGGTGAGGGTTTATCAGCTCAGGGACAGTAAAGCGATTGATGCCGCTGATTACCAGACGCTGCTGCGCA
AGGCAGATACGGTACTTAACGACGATGTGCTGGCGTCGAAAGAGCTGCTGGTGATGCCCAACGGCAGCGT
GACGCTCAATATGCCTATGGATGAAGATGCTCAGTTCGTGGCTGTTGTGGGGTTGTTTAACCGCCCGGAT
CAGAAGGACAACCGCTGGCGGCTGGTACTGACCCGTGACGACCTCGATCCGGACAAACCCCGGATCATCG
AGCTGGGTGATGGCTGGCTCAGCCTTGTGCCGGTAAAGGAGTGA