SecReT6
Protein ID: 161504488
SecReT6 ID237
T6SS typei2
Gene symbol-
Locus tagSARI_02601
StrainSalmonella enterica subsp. arizonae serovar 62:z4,z23:- str. RSK2980
Repliconchromosome [GenBank: NC_010067] [Browse all T6SS(s) in this replicon]
Location [Strand]2519528..2519797 [-]
Producthypothetical protein
NoteTssE
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 7.40E-06, Aligned region: 9..55
Protein Sequence: 89 a.a.     [Download]
>gi|161504488|ref|YP_001571600.1| hypothetical protein SARI_02601 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
MTKILQGMPGTAHELIDTLAGVLLKYEPRLQSLNVTLLEQQVPGELRYAIDAELRGIGLVRYGTEFMPEG
KVLIRHLKQQQYLENHQYI
 
Nucleotide Sequence: 270 bp     [Download]
>ref|NC_010067.1|:c2519797-2519528 hypothetical protein SARI_02601 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
ATGACCAAAATTCTGCAAGGAATGCCCGGGACAGCCCACGAACTGATCGATACGTTGGCCGGTGTCCTGC
TCAAGTATGAACCCCGTTTGCAGTCACTCAATGTCACTTTACTTGAACAGCAAGTGCCTGGTGAGCTACG
TTACGCCATTGATGCGGAGCTGAGAGGTATCGGACTTGTACGGTATGGCACCGAGTTTATGCCTGAAGGT
AAAGTGCTGATCAGGCATTTGAAACAGCAGCAATATCTGGAAAACCATCAGTATATTTAA