SecReT6
Protein ID: 161504491
SecReT6 ID237
T6SS typei2
Gene symbol-
Locus tagSARI_02604
StrainSalmonella enterica subsp. arizonae serovar 62:z4,z23:- str. RSK2980
Repliconchromosome [GenBank: NC_010067] [Browse all T6SS(s) in this replicon]
Location [Strand]2523754..2524278 [-]
Producthypothetical protein
NoteTssJ
UniProt IDA9MMY6
KEGG IDses:SARI_02604
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.60E-36, Aligned region: 16..164
Protein Sequence: 174 a.a.     [Download]
>gi|161504491|ref|YP_001571603.1| hypothetical protein SARI_02604 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
MATVTRRWALTLIACSLLAGCGLTQTVTDGTVSITKSIFYKKIKTLHLDFTPRTAINADGAQTPLATMMR
VYQLRDRKAVDAADYQTLLRNADTVLNDDVLASKSLLVMPKGSVTLNMPMDEDAQFVAVVGLFNRPDQKD
NRWRLVLTRDDLDPDKPRTIELGDGWLSLVPVKE
 
Nucleotide Sequence: 525 bp     [Download]
>ref|NC_010067.1|:c2524278-2523754 hypothetical protein SARI_02604 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
ATGGCAACAGTAACCCGCCGGTGGGCGCTGACGCTTATTGCCTGTAGCCTGCTCGCAGGCTGCGGTCTGA
CGCAGACCGTCACGGACGGTACGGTCAGCATCACGAAATCCATCTTCTACAAGAAAATCAAAACGCTGCA
TCTGGATTTTACCCCGCGTACGGCCATTAACGCCGATGGCGCACAGACACCGCTGGCGACGATGATGAGA
GTCTATCAGCTCAGAGATCGTAAAGCGGTTGATGCCGCCGATTACCAGACACTGCTGCGTAATGCCGATA
CGGTACTTAACGACGATGTGCTGGCGTCAAAATCGCTGCTGGTGATGCCTAAAGGCAGCGTGACACTCAA
TATGCCTATGGATGAAGACGCTCAGTTCGTGGCTGTGGTGGGACTGTTTAACCGCCCGGATCAGAAGGAC
AACCGCTGGCGGCTGGTACTGACCCGTGACGATCTCGACCCGGACAAACCCCGCACGATTGAACTGGGTG
ATGGCTGGCTCAGCCTCGTGCCGGTGAAGGAGTGA