SecReT6
Protein ID: 161504492
SecReT6 ID237
T6SS typei2
Gene symbol-
Locus tagSARI_02605
StrainSalmonella enterica subsp. arizonae serovar 62:z4,z23:- str. RSK2980
Repliconchromosome [GenBank: NC_010067] [Browse all T6SS(s) in this replicon]
Location [Strand]2524314..2525396 [-]
Producthypothetical protein
NoteTssG
UniProt IDA9MMY7
KEGG IDses:SARI_02605
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.30E-80, Aligned region: 18..321
Protein Sequence: 360 a.a.     [Download]
>gi|161504492|ref|YP_001571604.1| hypothetical protein SARI_02605 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
MARELQPARTRLTLTLNKDIWRANFYRFCQLLEQENPDAPKLGTTSHPGDDPVRFRPWPGMGFPVSTLKA
VETDEDHPTLPPTVRTTFLGMYGVDSPLPTSWLDDIAQRREGHEAVTSFLDIFSHRITTQYYRIWRKYAY
PATFEAGGRDATSQCLLGLVGLGIPGTAEQVATPVSRFLALLGTMRLPTRNAEGIRALVSLLAPNTRAII
TEPDPVKVHIDNRSGLGAGNWIRLSQRATLGKTAKEACSRVLVTLETEDPGEAEGWLPGGLLHTDLLVLL
RVYLGYRSDARLRLTVPVRLLPEPRLGKGRRIQLGRTGLLGLKAGKLSNNRESLTVSLGCYEGLQCSALP
PAEDGHYRFN
 
Nucleotide Sequence: 1083 bp     [Download]
>ref|NC_010067.1|:c2525396-2524314 hypothetical protein SARI_02605 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
ATGGCGCGAGAATTACAGCCAGCACGTACCAGGCTGACGTTAACACTCAATAAAGATATCTGGCGGGCCA
ATTTCTACCGTTTCTGCCAGTTGCTGGAGCAGGAAAATCCGGACGCGCCAAAGCTGGGAACCACCAGCCA
TCCGGGCGACGACCCGGTAAGATTCAGACCGTGGCCTGGTATGGGGTTCCCGGTCAGTACCCTGAAAGCG
GTGGAGACCGACGAAGACCATCCGACATTGCCCCCAACGGTCCGCACGACATTTCTGGGGATGTATGGCG
TGGACTCGCCTCTGCCGACGTCCTGGCTGGACGATATTGCTCAGCGCCGCGAAGGGCACGAGGCGGTCAC
CTCGTTTCTGGATATTTTCAGCCACCGCATCACCACCCAGTACTATCGGATCTGGCGAAAATACGCCTAT
CCGGCCACCTTCGAGGCAGGTGGCCGCGATGCCACATCACAGTGTCTGCTCGGTCTGGTGGGGCTCGGTA
TACCGGGTACGGCTGAGCAGGTGGCAACGCCGGTTTCCCGCTTTCTGGCCCTGCTGGGCACCATGCGATT
ACCGACCCGCAATGCGGAAGGCATTCGGGCTCTGGTGAGCCTGCTTGCACCGAATACCCGGGCAATTATC
ACCGAACCCGATCCGGTGAAGGTCCATATCGATAACCGCAGCGGGCTGGGTGCCGGAAACTGGATCCGTC
TTTCGCAGCGAGCCACGCTGGGCAAAACCGCAAAAGAAGCATGCAGTCGGGTACTGGTGACCCTGGAAAC
GGAAGATCCAGGTGAGGCAGAAGGCTGGTTACCCGGCGGTTTACTCCATACCGATTTGCTGGTCCTGCTA
CGCGTTTATCTCGGCTACCGCAGTGACGCCCGACTACGCCTCACCGTACCCGTACGATTGCTGCCTGAGC
CTCGACTTGGCAAAGGCAGGCGCATTCAACTGGGCCGCACCGGTTTGCTGGGTCTGAAAGCAGGCAAACT
CAGCAATAACCGGGAGAGTCTCACCGTCAGTCTGGGCTGCTATGAAGGGCTGCAATGTTCTGCGTTACCG
CCCGCTGAAGACGGGCATTACCGCTTCAACTAA