SecReT6
Protein ID: 161504493
SecReT6 ID237
T6SS typei2
Gene symbol-
Locus tagSARI_02606
StrainSalmonella enterica subsp. arizonae serovar 62:z4,z23:- str. RSK2980
Repliconchromosome [GenBank: NC_010067] [Browse all T6SS(s) in this replicon]
Location [Strand]2525360..2527129 [-]
Producthypothetical protein
NoteTssF
UniProt IDA9MMY8
KEGG IDses:SARI_02606
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 9.10E-183, Aligned region: 6..586
XS [PF03468], Evalue: 0.0092, Aligned region: 61..113
Protein Sequence: 589 a.a.     [Download]
>gi|161504493|ref|YP_001571605.1| hypothetical protein SARI_02606 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
MDDLTLRYYEAEMRYLREAGKEFARAHPDRAAMLNLDKPGARDPYVERLFEGFAFLMGRLREKLDDDLPE
LTEGLVSLLWPHYMRTIPSLAIVEFSPDWHSLRQAEMLAEGFSVLSRPVGPQKTACQYRTTRDVPLQPLH
LADARLHTETDGRSAIRLRFECPEKVDWSKAGIDKVAIFLNAESPVSSALHLAMTRRVHAMFARHAGTHT
ERHQFDGWCKPMGFDDNDGLWKKADTAFSGYQLLLEYFSFRPKFMFVELRGLDAIGLTAASTWFEIDIVL
SEAWSSDLPFETENFRLHCAPVINLFTLEADPLTLDPLENEYLLRPLRLQDGHTEIYSVDNIHGAVKNGK
HPYVPFTSFRHRGGMMRHDAPERYFHTRVKRGPSGLYDTWLILGGRSFELEQLSEKPESLSMRITGTNGQ
LPRKALESTLLDRVVKAGKVPVRVLNVTAPTMPLYPPANDRFHWRVMSHLGSNFLSMMDNPEVLRGTLAL
YDWTDDEMNRRRLEAIVAVKHTLIRRFEKGFMLRGVDIEVTLNTDNFAGEGDVNLFGEMLHRFFALYADI
HLFNQLTLVLQPTGKRLRWRENYSQHVPG
 
Nucleotide Sequence: 1770 bp     [Download]
>ref|NC_010067.1|:c2527129-2525360 hypothetical protein SARI_02606 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
ATGGATGATTTAACCCTGCGCTATTACGAAGCCGAAATGCGCTACCTGCGCGAAGCAGGTAAAGAGTTTG
CCCGGGCCCACCCGGACCGGGCGGCAATGCTTAATCTGGATAAACCCGGCGCTCGCGATCCCTACGTAGA
GCGCCTGTTCGAAGGTTTTGCCTTTCTGATGGGCCGTCTGCGTGAAAAGCTTGATGACGATCTGCCGGAA
CTGACCGAAGGGCTGGTGAGCCTGCTGTGGCCGCACTATATGCGGACCATCCCGTCGCTGGCCATCGTCG
AGTTCTCCCCTGACTGGCATAGTCTGCGTCAGGCCGAAATGCTGGCTGAAGGCTTCTCCGTGCTGTCGCG
TCCTGTCGGGCCGCAAAAAACCGCCTGTCAGTACCGGACGACTCGCGATGTGCCGCTACAACCGCTGCAT
CTTGCGGACGCCCGCCTGCACACGGAAACCGATGGTCGCTCTGCTATTCGCCTGCGCTTCGAATGCCCTG
AAAAAGTGGACTGGAGTAAAGCCGGGATCGACAAAGTCGCCATATTCCTTAACGCAGAGAGTCCGGTCAG
TTCAGCGCTGCATCTGGCAATGACCCGTCGTGTTCACGCGATGTTTGCCCGTCATGCCGGGACGCACACA
GAACGTCATCAGTTTGACGGCTGGTGCAAACCGATGGGCTTTGATGATAATGACGGCCTGTGGAAGAAGG
CGGATACGGCCTTCAGCGGTTACCAGCTGCTGCTGGAATATTTCAGTTTCCGTCCAAAGTTTATGTTCGT
TGAACTGCGTGGCCTCGACGCCATCGGGCTCACTGCGGCCAGCACCTGGTTTGAAATCGATATTGTGCTC
AGTGAAGCCTGGTCATCCGATCTGCCTTTTGAGACGGAGAACTTCCGGCTGCACTGTGCGCCGGTCATTA
ATCTCTTTACGCTGGAAGCCGACCCTCTGACGCTCGACCCGCTGGAAAATGAATACCTGCTCAGGCCGCT
GCGTCTTCAGGATGGTCACACCGAGATTTACAGCGTCGATAACATTCATGGCGCAGTGAAGAATGGCAAA
CATCCTTATGTACCTTTCACCAGCTTTCGCCACCGGGGTGGCATGATGCGCCACGATGCACCTGAGCGTT
ACTTCCACACTCGCGTGAAACGTGGCCCTTCAGGACTCTATGACACCTGGCTCATTCTCGGGGGACGCTC
GTTCGAGCTGGAGCAACTGTCAGAAAAACCTGAATCCCTTTCGATGCGGATAACCGGTACCAACGGGCAG
CTTCCGCGCAAGGCGCTGGAAAGTACATTGCTGGACAGAGTGGTCAAGGCAGGTAAAGTTCCCGTCAGGG
TACTGAACGTCACAGCACCAACGATGCCGCTGTATCCCCCGGCTAACGACCGTTTTCACTGGCGGGTAAT
GAGTCACCTCGGATCAAACTTCCTCAGCATGATGGACAATCCGGAGGTTCTGCGGGGAACGCTGGCGCTC
TATGACTGGACCGACGATGAAATGAACCGCCGTCGGCTTGAAGCCATCGTTGCCGTGAAGCACACCCTGA
TCCGCCGTTTTGAGAAGGGCTTTATGCTCAGGGGCGTGGACATTGAGGTCACGCTGAATACGGATAATTT
TGCAGGCGAGGGGGATGTGAATCTGTTCGGCGAGATGCTGCACCGGTTCTTCGCGCTCTATGCGGATATT
CACCTCTTTAATCAGCTCACGCTGGTACTGCAACCGACAGGGAAACGACTGAGATGGCGCGAGAATTACA
GCCAGCACGTACCAGGCTGA