SecReT6
Protein ID: 161504494
SecReT6 ID237
T6SS typei2
Gene symbol-
Locus tagSARI_02607
StrainSalmonella enterica subsp. arizonae serovar 62:z4,z23:- str. RSK2980
Repliconchromosome [GenBank: NC_010067] [Browse all T6SS(s) in this replicon]
Location [Strand]2527163..2528782 [-]
Producthypothetical protein
NoteTssA
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 3.90E-16, Aligned region: 76..133
ImpA-rel_N [PF06812], Evalue: 3.90E-16, Aligned region: 306..318
ImpA-rel_N [PF06812], Evalue: 3.90E-16, Aligned region: 359..369
Protein Sequence: 539 a.a.     [Download]
>gi|161504494|ref|YP_001571606.1| hypothetical protein SARI_02607 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
MGKSMSSPEDLLTACATSQEERQRLISRANDALSLWDNWLHPFTPGSETGDDPAYDDNFQLMREEINKLS
GTDSTLLCELAQKCLCECAKDIRVVTWYVQARLSRDGEKGLSEGLLLLAAMLTRYGQACHPRRPTARKAA
LEWLNSAKVIDALLLWPEVDSNDAGLTAGAISLLESTVADWPEAEKPSFAGICTALENRLARSGGMEALV
PQNSSTQEHGREAAHSDSPQLSAVKSGRDLLDQAKLLSRWLSEQPQGWLASHRLIKTVRWDTVDQIPPLD
SSGRTRLVPPKVEYRAQLKRLYLQKNWTELVEQASQMFCEGVNHFWLDLQWYLWQGLSHAGHPWDAWTNS
VLLDLRLLLQRLPGLEGLAWNDGTPFADEVTTAWIAEKVNEGGLLYGDEPATVVNSQSDDVLLLESEAME
KGDAEGPEAALAWLQSRPGMDTPRHRWLIRLLMARVAEQYGRNDMALHLLGELTTSAPQLTLEDWEPALL
FEVQARRLKLLRLKAGRSESDKARLMPEMDTLLAGLIAIDPARAMVLCG
 
Nucleotide Sequence: 1620 bp     [Download]
>ref|NC_010067.1|:c2528782-2527163 hypothetical protein SARI_02607 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
ATGGGGAAATCAATGAGTTCACCGGAAGATCTGTTAACCGCCTGCGCCACCAGCCAGGAAGAAAGGCAGC
GCCTCATTTCCCGGGCAAATGATGCCCTGTCACTCTGGGATAACTGGCTGCACCCGTTCACCCCGGGGTC
TGAAACCGGGGACGATCCTGCTTACGATGATAATTTTCAGCTTATGCGTGAAGAGATCAATAAGCTTTCG
GGTACCGATTCAACGCTGTTGTGCGAGCTGGCCCAGAAGTGTCTTTGCGAATGTGCCAAAGACATACGTG
TTGTGACCTGGTACGTGCAGGCCCGACTCAGTCGCGACGGTGAAAAAGGGTTGTCCGAAGGCTTACTGCT
TCTTGCTGCGATGCTGACCCGCTACGGGCAGGCCTGCCATCCCCGGCGCCCCACTGCCCGGAAAGCTGCT
CTGGAGTGGCTGAACAGTGCAAAAGTGATTGATGCACTGCTGTTATGGCCCGAGGTGGACAGCAATGATG
CCGGTCTGACGGCGGGAGCCATAAGCCTGCTTGAATCCACAGTGGCAGACTGGCCGGAAGCCGAGAAACC
GTCTTTTGCAGGGATTTGTACCGCGCTTGAAAACCGCCTGGCACGTTCGGGTGGTATGGAAGCGCTGGTC
CCCCAGAACAGCAGTACTCAGGAGCACGGGCGTGAAGCTGCCCACTCGGATTCACCACAACTGTCAGCGG
TGAAATCGGGCCGCGATTTACTCGACCAGGCAAAGTTACTTTCCCGCTGGCTGAGCGAGCAGCCGCAGGG
CTGGCTGGCTTCTCACCGGCTGATAAAGACCGTGCGTTGGGACACGGTCGATCAGATCCCTCCGCTGGAC
AGTAGCGGGCGCACCCGTCTGGTACCGCCGAAGGTCGAGTACCGGGCTCAACTCAAGCGGCTCTACCTTC
AGAAAAACTGGACTGAACTGGTTGAGCAGGCCAGCCAGATGTTTTGCGAGGGAGTGAATCATTTCTGGCT
CGATCTCCAGTGGTATCTCTGGCAGGGGCTAAGCCATGCCGGTCACCCGTGGGATGCCTGGACAAACTCC
GTCCTTCTCGATCTGCGGCTTCTTCTTCAGCGCCTTCCTGGCCTTGAAGGGCTGGCATGGAATGACGGAA
CTCCCTTCGCTGATGAAGTCACCACCGCCTGGATCGCTGAAAAAGTGAATGAGGGAGGTCTGCTGTACGG
TGATGAACCCGCCACCGTTGTTAATAGCCAGTCCGACGATGTACTGCTTCTTGAATCCGAAGCTATGGAA
AAAGGTGACGCGGAAGGACCCGAGGCGGCGCTTGCCTGGCTCCAGTCCCGACCGGGGATGGACACACCAC
GCCATCGCTGGCTGATACGCCTGTTGATGGCCCGGGTGGCAGAGCAGTATGGTCGAAACGATATGGCGCT
TCACCTGCTTGGCGAACTGACCACCAGTGCACCACAGCTGACGCTGGAAGACTGGGAACCCGCACTGTTG
TTTGAAGTCCAGGCTCGCCGCCTGAAACTGCTGCGCCTGAAAGCCGGTCGCAGCGAATCCGATAAAGCCC
GTCTGATGCCTGAGATGGATACGCTACTGGCGGGTCTGATCGCCATCGACCCGGCCCGTGCCATGGTGCT
CTGTGGTTAA