SecReT6
Protein ID: 161504513
SecReT6 ID237
T6SS typei2
Gene symbol-
Locus tagSARI_02626
StrainSalmonella enterica subsp. arizonae serovar 62:z4,z23:- str. RSK2980
Repliconchromosome [GenBank: NC_010067] [Browse all T6SS(s) in this replicon]
Location [Strand]2547387..2549744 [-]
Producthypothetical protein
NoteTssI
UniProt IDA9MN08
KEGG IDses:SARI_02626
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.60E-62, Aligned region: 42..355
Phage_GPD [PF05954], Evalue: 1.60E-62, Aligned region: 496..526
DUF2345 [PF10106], Evalue: 2.40E-39, Aligned region: 610..755
T6SS_Vgr [PF13296], Evalue: 6.70E-37, Aligned region: 327..360
T6SS_Vgr [PF13296], Evalue: 6.70E-37, Aligned region: 486..591
T6SS_Vgr [PF13296], Evalue: 6.70E-37, Aligned region: 634..653
Phage_base_V [PF04717], Evalue: 2.60E-16, Aligned region: 18..37
Phage_base_V [PF04717], Evalue: 2.60E-16, Aligned region: 402..481
Protein Sequence: 785 a.a.     [Download]
>gi|161504513|ref|YP_001571625.1| hypothetical protein SARI_02626 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
MSSFLSNKATSLVHQLLGQSRYRVDVHECSHFLDVLRYSAVESLSQPWRYDVAVTCTSADIACDTLLLKP
ASFTFQTPVFDGTPALPVRTVFGVVESFRRVSTSNDETHYALTIVPRIALLGYTKGSEIYLNQSVIEVVE
QVLRKHGLEGPDFEFRLSREYPSRELITQWRETDLEFIQRLLAEVGIYWRYEMDSRLEQDVVIFQDSQQQ
YEFGVTLPLRNQAGMSDSGQESIWDIQTAYNVVSGSVATRDYNYRDALTPQDSAESIFSKEGITTGETYH
YAEPFLTAGDADSPETGAYFARLRHERILNAQYRVSGHSSSPHLAPGQVLETDGTLPDAVKDGIVITTVR
TSGSRKSSFTMTFEGIPYSETVCWRPALLNRPVISGSLPARVESTQKGDTYSWLDPQGRYRVKLDLDRNS
PEQGYAYLWLRLAKPYAGDTYGFHSPLIDGTEVAVVFDGGDPDRPYIAYALHDSEHPDHVTSDNHTRNVW
RTPANNKLRMEDKRQEEHIKLATEYGKTQLNMGHLVNSQREKRGAGFELRTDEHGAVRAAKGLFLTADAQ
AKAQGPVLEMAPAINQINQANSQMQALNSAAEAAGALVSDISTQVNLVRDRLKDLQSAVLLASAPQGVAF
TSGEHLQLSSARNTMINAGQHLDIGAMKNLSVSVEKALGMFVHKGGAKVVANQGDIELQAQHNTMALFSE
KQLTVTSSEDEIIISTPETLTLNGGGSYLRLSKNGIEHGSEGIMVMKVASYLVPGTGASQQMETPDFKTT
DVTVTRKNSAKWTSE
 
Nucleotide Sequence: 2358 bp     [Download]
>ref|NC_010067.1|:c2549744-2547387 hypothetical protein SARI_02626 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
ATGAGCAGTTTCCTCTCCAACAAGGCTACCAGCCTGGTACATCAGCTTTTAGGGCAATCACGGTACCGGG
TTGATGTGCATGAATGCAGCCATTTCCTGGATGTGTTGCGTTACAGTGCGGTGGAGTCCCTCAGCCAGCC
CTGGCGGTATGACGTGGCGGTGACCTGCACCTCTGCGGATATCGCCTGCGACACGTTACTGCTGAAGCCG
GCGTCATTCACTTTCCAGACCCCCGTGTTTGACGGAACACCGGCCCTGCCTGTAAGGACGGTATTCGGCG
TGGTTGAGTCGTTTCGCCGCGTGTCTACCTCGAATGATGAGACCCATTACGCGCTGACGATCGTTCCCCG
TATTGCCCTTCTGGGCTATACGAAAGGGAGCGAGATCTACCTCAATCAGTCGGTTATTGAGGTGGTTGAA
CAGGTATTGCGTAAACACGGGCTGGAAGGGCCTGATTTTGAGTTCCGGCTCTCCCGGGAATATCCCTCCC
GGGAGCTCATTACCCAGTGGCGGGAAACTGACCTTGAGTTTATCCAGCGCCTGCTGGCGGAGGTGGGCAT
TTACTGGCGCTATGAAATGGACAGCCGTCTTGAACAGGACGTTGTGATTTTCCAGGACAGCCAGCAGCAG
TATGAATTTGGTGTCACGCTGCCATTACGCAACCAGGCCGGGATGAGTGACAGCGGGCAGGAGAGCATCT
GGGATATTCAGACCGCATATAACGTGGTAAGCGGAAGTGTGGCCACCCGTGACTACAACTACCGTGATGC
ACTGACGCCTCAGGACAGCGCCGAAAGTATTTTCAGCAAAGAGGGGATCACGACCGGGGAAACGTATCAT
TACGCGGAACCCTTCCTGACGGCAGGTGACGCTGATAGCCCGGAGACCGGGGCATACTTCGCCCGCCTGC
GTCACGAACGCATTCTGAACGCGCAGTATCGCGTCAGCGGGCATTCCTCCAGCCCTCATCTGGCGCCGGG
GCAGGTACTGGAAACAGATGGCACGTTGCCGGATGCGGTGAAAGACGGAATTGTCATCACGACCGTACGT
ACCAGCGGTTCACGCAAAAGTAGCTTTACGATGACGTTTGAGGGTATCCCCTATAGCGAAACTGTCTGCT
GGCGCCCTGCGTTGCTTAATCGCCCGGTGATATCCGGATCGCTCCCGGCCCGGGTGGAAAGCACACAGAA
AGGCGACACCTATTCCTGGCTCGATCCGCAGGGCCGCTACCGTGTGAAACTGGACCTTGACCGCAACAGT
CCTGAACAGGGTTATGCCTATTTGTGGTTGCGGCTGGCTAAGCCCTATGCCGGGGATACCTACGGATTCC
ACTCACCGCTTATCGACGGAACTGAAGTGGCCGTAGTATTTGACGGCGGAGATCCGGATCGTCCCTACAT
CGCTTATGCCCTGCATGACTCAGAACATCCGGACCACGTCACCAGTGACAATCATACGCGGAATGTGTGG
CGCACCCCGGCGAACAATAAGCTGCGGATGGAGGATAAGCGCCAGGAAGAGCATATCAAGCTCGCGACGG
AATACGGCAAAACGCAGCTGAACATGGGGCACCTGGTCAACAGCCAGCGTGAAAAACGCGGCGCCGGTTT
TGAACTGCGTACGGATGAGCATGGCGCAGTTCGTGCAGCAAAAGGCCTCTTCCTGACAGCAGATGCGCAG
GCCAAAGCGCAGGGGCCGGTGCTTGAAATGGCCCCAGCCATCAACCAGATTAACCAGGCCAACAGCCAGA
TGCAGGCGCTGAACAGTGCCGCAGAAGCGGCCGGAGCGCTGGTATCCGATATCAGCACCCAAGTCAACCT
GGTCAGGGACAGGCTGAAGGATCTTCAGTCGGCGGTACTGCTGGCGAGCGCCCCGCAGGGCGTGGCATTT
ACCTCAGGTGAACACCTTCAGCTCAGCAGCGCCCGCAACACGATGATTAATGCAGGCCAGCACCTTGATA
TCGGAGCGATGAAGAATCTGTCCGTGAGCGTGGAAAAAGCCCTGGGAATGTTTGTGCATAAAGGCGGGGC
GAAGGTTGTCGCCAACCAGGGAGACATCGAGCTCCAGGCTCAGCACAATACCATGGCATTGTTTTCAGAA
AAGCAGTTGACGGTGACCAGTAGCGAAGACGAAATTATTATCAGCACCCCGGAAACACTGACGCTTAACG
GTGGTGGGTCATATCTGCGCCTGAGTAAGAACGGAATTGAACATGGATCTGAGGGGATAATGGTGATGAA
GGTTGCGAGCTACCTGGTGCCGGGCACAGGTGCCAGCCAGCAGATGGAAACACCGGACTTTAAAACGACG
GACGTGACGGTCACAAGAAAAAACTCTGCCAAATGGACGAGTGAATAA