SecReT6
Protein ID: 161504514
SecReT6 ID237
T6SS typei2
Gene symbol-
Locus tagSARI_02627
StrainSalmonella enterica subsp. arizonae serovar 62:z4,z23:- str. RSK2980
Repliconchromosome [GenBank: NC_010067] [Browse all T6SS(s) in this replicon]
Location [Strand]2549741..2552413 [-]
Producthypothetical protein
NoteTssH
UniProt IDA9MN09
KEGG IDses:SARI_02627
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 7.70E-41, Aligned region: 241..260
AAA_2 [PF07724], Evalue: 7.70E-41, Aligned region: 616..780
AAA [PF00004], Evalue: 3.30E-18, Aligned region: 243..355
AAA [PF00004], Evalue: 3.30E-18, Aligned region: 620..738
AAA [PF00004], Evalue: 3.30E-18, Aligned region: 768..785
AAA_5 [PF07728], Evalue: 2.60E-14, Aligned region: 144..180
AAA_5 [PF07728], Evalue: 2.60E-14, Aligned region: 243..263
AAA_5 [PF07728], Evalue: 2.60E-14, Aligned region: 341..373
AAA_5 [PF07728], Evalue: 2.60E-14, Aligned region: 619..738
ClpB_D2-small [PF10431], Evalue: 2.30E-12, Aligned region: 491..514
ClpB_D2-small [PF10431], Evalue: 2.30E-12, Aligned region: 786..861
AAA_16 [PF13191], Evalue: 1.20E-10, Aligned region: 220..264
AAA_16 [PF13191], Evalue: 1.20E-10, Aligned region: 288..321
AAA_16 [PF13191], Evalue: 1.20E-10, Aligned region: 393..485
AAA_16 [PF13191], Evalue: 1.20E-10, Aligned region: 607..643
AAA_16 [PF13191], Evalue: 1.20E-10, Aligned region: 683..713
AAA_16 [PF13191], Evalue: 1.20E-10, Aligned region: 758..804
AAA_22 [PF13401], Evalue: 9.50E-09, Aligned region: 242..328
AAA_22 [PF13401], Evalue: 9.50E-09, Aligned region: 615..654
AAA_25 [PF13481], Evalue: 8.70E-08, Aligned region: 243..267
AAA_25 [PF13481], Evalue: 8.70E-08, Aligned region: 297..331
AAA_25 [PF13481], Evalue: 8.70E-08, Aligned region: 616..648
Clp_N [PF02861], Evalue: 1.10E-07, Aligned region: 23..58
Clp_N [PF02861], Evalue: 1.10E-07, Aligned region: 105..126
AAA_23 [PF13476], Evalue: 2.20E-07, Aligned region: 243..260
AAA_23 [PF13476], Evalue: 2.20E-07, Aligned region: 446..541
AAA_23 [PF13476], Evalue: 2.20E-07, Aligned region: 616..643
Zeta_toxin [PF06414], Evalue: 1.10E-06, Aligned region: 237..267
Zeta_toxin [PF06414], Evalue: 1.10E-06, Aligned region: 605..659
IstB_IS21 [PF01695], Evalue: 1.20E-06, Aligned region: 237..303
IstB_IS21 [PF01695], Evalue: 1.20E-06, Aligned region: 618..637
Arch_ATPase [PF01637], Evalue: 7.00E-06, Aligned region: 221..258
Arch_ATPase [PF01637], Evalue: 7.00E-06, Aligned region: 295..392
Arch_ATPase [PF01637], Evalue: 7.00E-06, Aligned region: 613..633
Arch_ATPase [PF01637], Evalue: 7.00E-06, Aligned region: 689..701
AAA_19 [PF13245], Evalue: 1.00E-05, Aligned region: 240..266
AAA_19 [PF13245], Evalue: 1.00E-05, Aligned region: 616..637
NACHT [PF05729], Evalue: 1.90E-05, Aligned region: 107..150
NACHT [PF05729], Evalue: 1.90E-05, Aligned region: 243..273
NACHT [PF05729], Evalue: 1.90E-05, Aligned region: 619..637
AAA_17 [PF13207], Evalue: 2.10E-05, Aligned region: 243..306
AAA_17 [PF13207], Evalue: 2.10E-05, Aligned region: 618..654
Sigma54_activat [PF00158], Evalue: 3.40E-05, Aligned region: 226..257
Sigma54_activat [PF00158], Evalue: 3.40E-05, Aligned region: 618..736
AAA_29 [PF13555], Evalue: 0.00015, Aligned region: 237..259
AAA_29 [PF13555], Evalue: 0.00015, Aligned region: 616..645
AAA_14 [PF13173], Evalue: 0.0002, Aligned region: 243..333
AAA_14 [PF13173], Evalue: 0.0002, Aligned region: 617..701
DUF258 [PF03193], Evalue: 0.0012, Aligned region: 225..260
DUF258 [PF03193], Evalue: 0.0012, Aligned region: 616..631
SRP54 [PF00448], Evalue: 0.002, Aligned region: 243..265
SRP54 [PF00448], Evalue: 0.002, Aligned region: 478..510
SRP54 [PF00448], Evalue: 0.002, Aligned region: 618..649
AAA_18 [PF13238], Evalue: 0.0023, Aligned region: 243..263
AAA_18 [PF13238], Evalue: 0.0023, Aligned region: 620..639
RNA_helicase [PF00910], Evalue: 0.003, Aligned region: 244..265
RNA_helicase [PF00910], Evalue: 0.003, Aligned region: 620..640
RNA_helicase [PF00910], Evalue: 0.003, Aligned region: 717..738
Protein Sequence: 890 a.a.     [Download]
>gi|161504514|ref|YP_001571626.1| hypothetical protein SARI_02627 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
MEHHSAVLLRRLNPYCARALEGAASLCQARAHAEITPEHWLLKLLEQGEGDLTVLARRYEWDMDAVWQSL
LSWLDAQPRSVRTRPELSASLQTLVKQAWLAATLAGDEQIRSIHLLTAMIETSGLTRCDGLWPLMTLTTS
QLERLRPLLEAQSDERHDVTLSEQPGNVSIIGRAAPLQHEAQHQSEGGSVQPAVSQEESVLNRFTVDVTA
RAREGKIDPVFGRDNEIRQMVDILSRRRKNNPILVGEPGVGKTALVEGLALRIAEGNVPESLKPVIVRTL
DLGLLQAGAGVKGEFEQRLKNIIDAVQHFPVPVLLFIDEAHTIIGAGNQAGGADAANLLKPALARGELRT
IAATTWSEYKQYFERDAALERRFQMVKVDEPDDDTACLMLRGLKSRYAEHHGVHITGEAVRAAVTLSRRY
LTGRQLPDKAVDLLDTAAARVRMSLDTLPEQLTRLQAELTALAMEQQELLEDISLGNAVDASRLPQIEQL
SLELNQQKAALQSQYETEKQLTDSLKACREDISRQEELSALQHELSQIQNNSPLLGLDVDVRTVATVIAD
WTGVPLSSLMKDEQTELLTLEEQLATRVVGQGPALNAIAERMRASKTGLTPENGQQGVFLLVGPSGVGKT
ETALALADVMYGGEKSLITINLSEYQEPHTVSQLKGSPPGYVGYGQGGILTEAVRKRPYSVVLLDEVEKA
HRDVMNLFYQVFDRGFMRDGEGREIDFRNTVILMTSNLGSDPLMQFLEEQPEATESDLHELLRPILRDHF
QPALLARFQTVIYRPLEMDAMRTIVGIKLAQVSTRLQRHYGISTHIGESLFDTLTKACLLTDTGARNVDS
LLNQQILPVLSQQLLSHMAAKQKPSSLQLTWDDEEGIVLAFDAQVEGEPS
 
Nucleotide Sequence: 2673 bp     [Download]
>ref|NC_010067.1|:c2552413-2549741 hypothetical protein SARI_02627 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
ATGGAACATCATTCAGCAGTCCTGCTACGACGACTTAACCCTTATTGCGCCAGAGCACTGGAGGGGGCGG
CTTCTTTATGTCAGGCCCGTGCGCATGCAGAAATCACGCCTGAGCACTGGTTGCTGAAACTGCTGGAGCA
GGGGGAAGGTGACCTGACCGTTCTTGCCCGGCGCTATGAATGGGATATGGATGCCGTCTGGCAGTCGCTC
CTGAGCTGGCTGGATGCACAGCCTCGTTCAGTTCGCACACGCCCGGAGCTTTCTGCTTCCCTCCAGACCT
TAGTGAAACAGGCGTGGCTTGCCGCCACGCTCGCGGGAGATGAGCAGATCCGCAGCATACATTTGCTCAC
GGCCATGATTGAAACGTCAGGGCTGACACGCTGCGATGGCCTCTGGCCTTTGATGACGCTGACCACCAGC
CAGCTGGAAAGGTTACGTCCCTTGCTGGAAGCCCAGTCGGATGAGCGGCATGACGTTACGCTCAGTGAGC
AGCCTGGCAATGTCAGCATTATTGGCCGGGCCGCACCGTTACAGCATGAAGCACAACACCAGTCTGAAGG
CGGAAGTGTGCAGCCTGCCGTTTCACAGGAAGAGTCCGTTCTCAATCGCTTTACGGTCGATGTGACCGCC
CGTGCCCGGGAAGGAAAGATTGACCCGGTCTTTGGACGCGATAACGAAATCCGTCAGATGGTGGATATTC
TCTCCAGACGCCGTAAGAACAACCCGATCCTCGTGGGTGAACCCGGCGTGGGCAAAACGGCCCTGGTTGA
AGGCCTGGCGCTGCGTATTGCTGAGGGCAATGTGCCCGAAAGTCTTAAGCCCGTCATCGTCAGGACACTG
GATCTGGGTTTGCTTCAGGCGGGTGCCGGTGTAAAGGGTGAATTCGAACAGCGTCTGAAAAATATCATCG
ACGCCGTACAGCACTTCCCGGTGCCGGTGCTGCTGTTTATTGATGAGGCACACACCATTATCGGGGCGGG
TAATCAGGCAGGCGGGGCAGATGCGGCTAACCTGCTGAAACCAGCGCTGGCTCGCGGCGAACTGCGCACC
ATTGCGGCCACCACATGGAGTGAATACAAGCAGTATTTCGAACGTGACGCCGCCCTGGAGCGCCGCTTCC
AGATGGTCAAGGTTGATGAGCCCGATGATGATACGGCCTGCCTGATGCTGCGCGGTCTAAAATCCCGCTA
TGCCGAACATCATGGCGTACATATTACCGGCGAGGCCGTCCGGGCAGCGGTGACGCTATCCCGTCGTTAC
CTGACCGGACGCCAGTTGCCAGATAAAGCCGTGGACCTGCTGGATACCGCAGCGGCCCGGGTGCGGATGA
GTCTGGACACGCTGCCAGAACAGCTTACCCGGTTGCAGGCTGAACTGACTGCGCTTGCCATGGAGCAGCA
GGAGTTGCTGGAAGATATTTCTCTGGGTAACGCTGTTGATGCCAGCCGTCTGCCTCAGATCGAGCAACTT
TCGCTGGAGCTCAATCAGCAGAAAGCTGCCCTTCAGTCACAATATGAGACCGAAAAGCAGCTCACCGACT
CGCTGAAAGCCTGCCGTGAAGACATCAGCCGCCAGGAGGAGCTCTCCGCCCTTCAGCACGAGCTTTCTCA
GATTCAGAATAACAGTCCATTGCTGGGTCTGGATGTTGATGTCCGCACCGTTGCGACCGTTATCGCCGAC
TGGACAGGGGTTCCTCTCTCGTCGCTGATGAAGGATGAGCAGACCGAACTGCTGACGCTGGAAGAACAGC
TGGCAACCCGCGTAGTCGGTCAGGGTCCCGCCCTTAATGCCATTGCCGAGCGAATGAGGGCGTCAAAAAC
CGGCCTGACGCCGGAAAACGGACAGCAGGGGGTGTTTTTACTGGTGGGTCCAAGCGGAGTGGGCAAAACA
GAAACCGCGCTTGCGCTTGCTGACGTTATGTATGGTGGTGAGAAATCGCTCATTACCATCAACCTGTCTG
AATACCAGGAGCCACACACGGTCTCGCAGTTGAAAGGCTCCCCTCCGGGCTATGTAGGATATGGTCAGGG
CGGCATTCTCACCGAGGCAGTCCGTAAGCGGCCTTACAGCGTGGTGCTGCTCGATGAAGTGGAGAAGGCC
CATCGGGATGTAATGAATCTGTTTTATCAGGTCTTTGACCGGGGCTTTATGCGGGACGGAGAAGGGCGTG
AAATTGATTTTCGCAATACCGTGATCCTGATGACGTCCAACCTGGGAAGTGACCCGCTGATGCAGTTCCT
GGAAGAGCAACCAGAAGCCACTGAGAGCGATCTGCATGAGTTGTTACGCCCGATCCTGCGCGATCATTTC
CAGCCAGCGCTGCTGGCCCGCTTCCAGACGGTGATATACCGGCCGCTGGAAATGGATGCCATGCGCACCA
TCGTCGGCATAAAGCTCGCACAGGTGAGTACGCGTCTGCAACGCCACTACGGCATTTCCACGCACATTGG
CGAAAGTCTTTTCGACACGCTGACGAAGGCGTGTTTGCTGACGGATACCGGTGCCCGCAACGTGGACAGC
CTGCTTAATCAGCAGATCCTGCCGGTTCTGAGCCAGCAGCTATTAAGCCATATGGCGGCAAAACAAAAGC
CATCCTCGCTACAGCTGACCTGGGATGATGAAGAGGGCATTGTGCTGGCGTTTGATGCACAGGTAGAAGG
AGAGCCGTCATGA