SecReT6
Protein ID: 161504517
SecReT6 ID237
T6SS typei2
Gene symbol-
Locus tagSARI_02630
StrainSalmonella enterica subsp. arizonae serovar 62:z4,z23:- str. RSK2980
Repliconchromosome [GenBank: NC_010067] [Browse all T6SS(s) in this replicon]
Location [Strand]2554750..2555439 [-]
Producthypothetical protein
NoteTssL
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 9.90E-42, Aligned region: 7..216
Protein Sequence: 229 a.a.     [Download]
>gi|161504517|ref|YP_001571629.1| hypothetical protein SARI_02630 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
MRQDIDIDQLMAETWLTVTMLKKGAVTLDGTALYDKCVKQVETVREALERAGYDDASVEHISYAQCALLD
ETVMSRKSEKSEEGEEPKVDEGQVAWRKAPLQARFFGSLRAGEALWDRIAEVLRQPSPNPAVLTCYHRVI
ALGFQGLYSLKAVSQSQRDEVVKALSERVSPPDTGLSLVVHRMGKHRWSLMRSVWFWIVLAVILTGVIWW
GGHLWLQALLSAHIPELHG
 
Nucleotide Sequence: 690 bp     [Download]
>ref|NC_010067.1|:c2555439-2554750 hypothetical protein SARI_02630 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
ATGAGACAGGATATCGATATCGACCAGCTGATGGCGGAGACCTGGCTTACCGTCACTATGCTGAAGAAAG
GTGCCGTCACGCTTGATGGCACTGCTCTTTACGACAAGTGCGTTAAACAGGTTGAAACTGTGCGGGAAGC
GCTGGAGCGTGCCGGTTATGACGACGCCAGTGTGGAGCATATTTCCTACGCACAATGTGCCCTGCTGGAC
GAAACGGTGATGAGCCGTAAGTCTGAAAAAAGCGAGGAAGGAGAGGAGCCGAAAGTTGATGAAGGCCAGG
TGGCCTGGCGTAAAGCGCCGCTTCAGGCCCGTTTTTTTGGCTCACTTCGGGCTGGTGAAGCACTGTGGGA
CAGGATTGCAGAGGTTCTGCGTCAGCCCTCACCGAACCCGGCCGTTCTGACGTGCTATCACCGGGTGATC
GCCCTGGGCTTTCAGGGACTGTACAGCCTGAAAGCAGTCAGCCAGTCGCAGAGGGATGAGGTGGTCAAAG
CCCTCTCTGAGCGCGTATCTCCGCCAGATACAGGCCTGTCTCTGGTTGTTCACCGGATGGGGAAACATCG
CTGGAGTCTGATGCGCTCTGTCTGGTTCTGGATAGTGCTCGCCGTCATTCTTACCGGCGTTATCTGGTGG
GGTGGCCACCTCTGGCTCCAGGCACTCTTGTCAGCACATATACCGGAGTTGCATGGCTAA