SecReT6
Protein ID: 161504518
SecReT6 ID237
T6SS typei2
Gene symbol-
Locus tagSARI_02631
StrainSalmonella enterica subsp. arizonae serovar 62:z4,z23:- str. RSK2980
Repliconchromosome [GenBank: NC_010067] [Browse all T6SS(s) in this replicon]
Location [Strand]2555436..2556785 [-]
Producthypothetical protein
NoteTssK
UniProt IDA9MNK6
KEGG IDses:SARI_02631
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.50E-123, Aligned region: 18..446
Protein Sequence: 449 a.a.     [Download]
>gi|161504518|ref|YP_001571630.1| hypothetical protein SARI_02631 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
MKIYRPLWNEGALLSPQQFQQQAEWESFRCAGASALASPFPWGVEKIEFNDSLLSSGLIQITQLRLWLED
GSLIDAQRSDLPPAPRELDASQLAGRDAVTVVIALPHMQPGVANVEQEGVSPDRPLRYREEWVTLQDAFG
SEEESMAVARFNFTIRFAHESNDSWKVCPVARLIRDGQNAWRQDPSFIPPVASFGASPVLRERLVLLNRQ
LRSRRQRLMTMRRESNERLADFAVADVSLFWLLNALNSHARVLTEYERFPSRPPEQVWAELARLAGSMLT
FSLDHDLDAIPGYDHEEPANAFPPLFDLITGLLEASLPSRVIALEMSRPDGQTWKANLHDIRLREEADLY
LSVRSDIPAWQVAEKFPALCQAGSPDDVREIYGAALKGIPLIPVSRVPAALPVRMENQYFALDMESPAAH
EMQEQGVCMFYVPELLGALELELFAVLRS
 
Nucleotide Sequence: 1350 bp     [Download]
>ref|NC_010067.1|:c2556785-2555436 hypothetical protein SARI_02631 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
ATGAAAATTTATCGTCCACTGTGGAACGAGGGGGCTTTACTGTCCCCTCAACAGTTCCAGCAGCAGGCTG
AATGGGAGTCTTTTCGCTGTGCCGGTGCATCAGCGCTGGCATCCCCATTCCCCTGGGGCGTGGAAAAGAT
TGAGTTTAATGACAGTCTTCTGTCGTCCGGTCTGATTCAGATTACGCAGTTACGTCTCTGGCTGGAAGAT
GGTTCGCTGATTGACGCACAAAGGAGCGATCTGCCTCCGGCGCCACGTGAGTTAGATGCCAGCCAGCTGG
CAGGTCGTGATGCGGTAACCGTCGTTATCGCACTGCCTCACATGCAGCCAGGTGTTGCCAACGTGGAACA
GGAAGGCGTTAGTCCAGACCGGCCGCTCCGTTATCGTGAAGAATGGGTGACTTTGCAGGATGCCTTTGGC
TCTGAAGAAGAATCCATGGCTGTTGCCCGGTTTAATTTCACCATCCGGTTTGCTCATGAAAGTAATGATT
CCTGGAAAGTCTGCCCGGTAGCAAGGCTTATCCGGGATGGACAAAATGCGTGGCGACAGGATCCGTCTTT
TATTCCTCCGGTGGCATCTTTTGGGGCAAGTCCGGTCCTTCGCGAACGTCTTGTGCTGCTCAATCGCCAG
CTTCGCTCCCGACGCCAGCGACTGATGACAATGCGTCGTGAAAGTAACGAAAGACTCGCCGATTTTGCCG
TCGCCGATGTATCCCTTTTCTGGTTGCTGAATGCGCTGAATTCCCACGCCAGGGTGCTGACGGAATACGA
ACGTTTTCCTTCCCGTCCGCCAGAACAGGTGTGGGCGGAGCTCGCTCGTCTGGCAGGCAGTATGCTGACT
TTTTCTCTGGACCATGATCTTGACGCCATACCGGGCTATGACCACGAGGAACCGGCCAACGCATTTCCTC
CGCTGTTTGACCTGATAACGGGTTTGCTGGAAGCAAGTCTGCCATCCCGGGTCATTGCTCTGGAAATGTC
CCGACCGGACGGACAGACCTGGAAAGCCAACCTCCACGATATCCGCCTGCGAGAAGAGGCCGATCTTTAT
CTCTCTGTGCGCTCGGATATCCCGGCCTGGCAGGTCGCCGAGAAATTCCCGGCACTCTGTCAGGCGGGCT
CACCTGATGATGTCCGCGAGATCTATGGTGCGGCACTCAAGGGGATCCCTTTGATCCCGGTGAGCAGGGT
CCCGGCAGCGTTGCCTGTACGCATGGAAAACCAGTACTTCGCACTTGATATGGAAAGCCCCGCTGCGCAT
GAAATGCAGGAGCAGGGGGTGTGTATGTTCTATGTGCCTGAGTTACTTGGTGCCCTGGAACTTGAACTGT
TTGCGGTATTGCGCTCATGA