SecReT6
Protein ID: 161504519
SecReT6 ID237
T6SS typei2
Gene symbol-
Locus tagSARI_02632
StrainSalmonella enterica subsp. arizonae serovar 62:z4,z23:- str. RSK2980
Repliconchromosome [GenBank: NC_010067] [Browse all T6SS(s) in this replicon]
Location [Strand]2556798..2558339 [-]
Producthypothetical protein
NoteTssC
UniProt IDA9MNK7
KEGG IDses:SARI_02632
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 7.60E-176, Aligned region: 88..509
Protein Sequence: 513 a.a.     [Download]
>gi|161504519|ref|YP_001571631.1| hypothetical protein SARI_02632 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
MSVNAETQSVQGNTTVLENNPDSVYASLFEKINLNPVSRLGDITEYQDESVMADASADERVTAAIQVFMQ
VISKSGQLVEKLDKSLLDSHIAELDYQISRQLDEVMHHPEFQRVESLWRGLKHTVDRTDFRQNVKIEILD
VSKDDLRQDFEDAPEIIQSGLYHHTYSMEYDQPGGEPIAAIISSYEFDSSAQDVALLRNISKVSAAAHMP
FIGSVGPKFFHKSSMEEVAAIKDIGNYFDRAEYIKWKAFRDSEDSRYIGLTMPRVLGRLPYGPDTVPVRS
FNYVEEVKGPDHEKYLWTNASFAFAANMVKSFINNGWCVQIRGPQAGGAVQDLPIHLYDLGTGNQVKIPS
EVMIPETREFEFSNLGFIPLSYYKNRDYSCFFSANSAQKPALYDTADATANSRINARLPYIFLLSRIAHY
LKLIQRENIGTTKDRRLLELELNTWVKGLVTEMTDPGDDLQASHPLRDAKVIVEDIEDNPGFFRVKLFAV
PHFQVEGIDVNLSLVSQMPKAKA
 
Nucleotide Sequence: 1542 bp     [Download]
>ref|NC_010067.1|:c2558339-2556798 hypothetical protein SARI_02632 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
ATGTCTGTGAATGCTGAAACACAATCGGTGCAGGGGAACACTACTGTACTTGAGAATAACCCAGACAGCG
TGTATGCCTCGCTGTTTGAAAAAATTAATCTGAATCCAGTTTCTCGCCTGGGTGACATTACTGAATATCA
GGACGAGAGCGTCATGGCCGATGCCTCGGCAGATGAGCGAGTGACCGCAGCCATTCAGGTTTTTATGCAG
GTTATTTCAAAATCAGGCCAACTAGTTGAGAAACTTGATAAATCGTTGCTTGATTCGCATATCGCAGAAC
TTGATTATCAAATTAGTCGCCAGCTCGATGAAGTTATGCACCACCCGGAGTTTCAACGCGTTGAGTCACT
CTGGCGCGGACTTAAGCACACGGTTGATCGCACAGATTTCCGCCAGAATGTAAAAATAGAAATACTTGAT
GTTTCTAAAGACGATCTGCGTCAGGATTTTGAAGACGCTCCGGAGATTATCCAGAGTGGCCTTTATCACC
ATACTTATTCGATGGAATACGATCAACCGGGTGGAGAGCCTATCGCTGCAATCATTTCGTCGTATGAATT
CGATTCCTCCGCTCAGGATGTAGCGTTACTCCGCAATATATCAAAAGTTTCAGCTGCCGCTCATATGCCG
TTTATTGGTTCTGTAGGACCGAAATTCTTCCATAAATCCAGCATGGAAGAAGTCGCGGCCATCAAAGACA
TCGGTAACTATTTTGACAGAGCTGAATATATCAAATGGAAAGCGTTCCGTGACTCTGAGGACTCCCGCTA
TATTGGGCTGACTATGCCACGAGTGTTGGGCCGTCTGCCGTATGGTCCGGATACCGTCCCGGTACGCAGT
TTCAACTATGTGGAGGAAGTGAAGGGACCTGATCACGAGAAGTATTTATGGACGAATGCGTCGTTTGCCT
TTGCTGCCAATATGGTGAAAAGTTTTATCAATAACGGCTGGTGCGTCCAAATTCGTGGCCCTCAGGCTGG
CGGTGCAGTTCAGGATCTGCCTATCCACCTGTACGACCTCGGTACCGGTAATCAGGTAAAAATCCCGTCC
GAAGTGATGATACCGGAAACCCGTGAGTTTGAATTCTCGAATCTGGGATTCATTCCGCTAAGCTATTATA
AAAACAGAGATTATTCCTGTTTCTTCAGCGCGAATTCCGCCCAGAAGCCTGCATTGTACGACACTGCGGA
TGCGACCGCCAACAGCCGCATCAATGCCCGTCTGCCATACATCTTCCTGTTGTCACGTATCGCGCACTAC
CTGAAGCTCATCCAGCGTGAAAATATCGGTACCACCAAAGACCGTCGCCTGCTTGAGCTGGAGCTTAATA
CCTGGGTGAAAGGTCTGGTAACTGAAATGACCGATCCGGGCGATGACCTCCAGGCTTCACACCCGCTTCG
CGATGCCAAAGTCATCGTTGAAGACATCGAGGACAACCCGGGTTTCTTCCGCGTGAAACTCTTTGCCGTC
CCTCACTTCCAGGTTGAAGGCATAGACGTCAACCTGTCGCTGGTATCCCAGATGCCTAAAGCAAAAGCAT
AA