SecReT6
Protein ID: 161504520
SecReT6 ID237
T6SS typei2
Gene symbol-
Locus tagSARI_02633
StrainSalmonella enterica subsp. arizonae serovar 62:z4,z23:- str. RSK2980
Repliconchromosome [GenBank: NC_010067] [Browse all T6SS(s) in this replicon]
Location [Strand]2558381..2558878 [-]
Producthypothetical protein
NoteTssB
UniProt IDA9MNK8
KEGG IDses:SARI_02633
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.90E-51, Aligned region: 7..160
Protein Sequence: 165 a.a.     [Download]
>gi|161504520|ref|YP_001571632.1| hypothetical protein SARI_02633 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
MADSSFQNEVPKARVNIQLDLHTGSAQKKVELPLKLLAVGNFSNGKETLPLSERSKLNISKNNFNSVLSE
LNPEVSIDVANTLRGDGSEENIKLSFSEMKDFEPEAIAKQIPQLRAMLAMRNLLRDLKSNLLDNAEFRRS
LETILKDPALSEELRQELNALAPAE
 
Nucleotide Sequence: 498 bp     [Download]
>ref|NC_010067.1|:c2558878-2558381 hypothetical protein SARI_02633 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
ATGGCAGATTCCAGCTTCCAGAATGAAGTGCCAAAAGCACGCGTCAACATCCAGCTTGACCTGCACACGG
GTTCCGCCCAAAAGAAAGTAGAGTTGCCCTTAAAACTTCTCGCGGTGGGAAACTTCAGCAACGGCAAAGA
AACCCTCCCGCTTTCTGAACGCAGTAAGTTAAATATTTCCAAAAACAACTTTAATAGCGTTCTGTCCGAG
CTTAACCCAGAGGTCAGCATTGATGTTGCTAATACCCTGAGAGGTGATGGTTCTGAAGAAAATATCAAAC
TCAGCTTTTCTGAAATGAAAGATTTCGAGCCTGAAGCAATAGCAAAGCAAATTCCTCAACTTCGTGCCAT
GTTAGCCATGCGTAATCTCCTTCGAGACCTCAAGTCAAACCTCCTGGATAATGCCGAGTTTCGCAGATCT
CTTGAAACCATACTGAAAGACCCGGCTCTGAGCGAAGAATTAAGACAAGAACTGAATGCCCTTGCACCTG
CCGAATAA