SecReT6
Protein ID: 161504598
SecReT6 ID238
T6SS typei2
Gene symbol-
Locus tagSARI_02712
StrainSalmonella enterica subsp. arizonae serovar 62:z4,z23:- str. RSK2980
Repliconchromosome [GenBank: NC_010067] [Browse all T6SS(s) in this replicon]
Location [Strand]2621843..2622295 [-]
Producthypothetical protein
NoteTssE
UniProt IDA9MNT6
KEGG IDses:SARI_02712
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 5.40E-15, Aligned region: 30..116
Protein Sequence: 150 a.a.     [Download]
>gi|161504598|ref|YP_001571710.1| hypothetical protein SARI_02712 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
MSESPRPSLYETLYGNFTGGLDLHQVSEQNQVILSVLDNMQRILNCRAGTLAHLPDYGLPDMTKILQGMP
GTAHELMGTLSAVLLKYEPRLKKIMVVLLEQNVPGELRYAIDAELKGIGLVRYGTEFMPEGRVLLRHLKQ
QQYLDTTTRL
 
Nucleotide Sequence: 453 bp     [Download]
>ref|NC_010067.1|:c2622295-2621843 hypothetical protein SARI_02712 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
ATGAGTGAGTCACCCCGTCCGTCACTGTATGAAACGCTCTACGGCAATTTCACTGGCGGCCTCGATTTGC
ATCAGGTCAGCGAGCAGAACCAGGTCATATTGTCAGTGCTTGACAATATGCAGCGCATCCTCAACTGCCG
TGCCGGCACGCTGGCGCATCTGCCAGACTATGGCCTGCCCGATATGACTAAAATCCTGCAGGGGATGCCG
GGTACTGCCCATGAGCTGATGGGCACCCTGTCTGCTGTTCTGCTCAAATATGAGCCTCGTCTGAAAAAAA
TAATGGTTGTCCTGCTGGAGCAGAACGTCCCCGGCGAGTTGCGTTATGCCATTGATGCTGAGCTGAAGGG
CATTGGCCTCGTACGCTATGGCACCGAGTTTATGCCCGAAGGGCGGGTTCTCCTGCGACACCTGAAGCAA
CAGCAGTATCTCGATACCACAACCCGTCTGTAA