SecReT6
Protein ID: 161504599
SecReT6 ID238
T6SS typei2
Gene symbol-
Locus tagSARI_02713
StrainSalmonella enterica subsp. arizonae serovar 62:z4,z23:- str. RSK2980
Repliconchromosome [GenBank: NC_010067] [Browse all T6SS(s) in this replicon]
Location [Strand]2622288..2622830 [-]
Producthypothetical protein
NoteTssJ
UniProt IDA9MNT7
KEGG IDses:SARI_02713
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 9.00E-39, Aligned region: 21..171
Protein Sequence: 180 a.a.     [Download]
>gi|161504599|ref|YP_001571711.1| hypothetical protein SARI_02713 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
MKMAITAGKFPLAALAAGITLILAGCGLTQKVTDGTVAVTKSIFYKQVKTLHLDIRAREAVNSNAGGVAL
STVVRIYQLKDRKTFDTTDYLSLFKADSQAIKADLLAEKDIRLQPGGAVTVDIPMEDSAQYVAVAGMFMS
PDQENNTWRVVLSSDDLDPDKARVIEAGNNQLTLKALKDE
 
Nucleotide Sequence: 543 bp     [Download]
>ref|NC_010067.1|:c2622830-2622288 hypothetical protein SARI_02713 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
ATGAAGATGGCGATTACCGCTGGTAAATTTCCCTTGGCTGCGCTGGCCGCAGGTATCACTCTGATACTGG
CGGGCTGTGGGCTGACTCAAAAAGTCACGGACGGTACGGTTGCCGTGACTAAATCGATTTTTTATAAGCA
GGTAAAAACCCTGCATCTTGATATTCGCGCCCGGGAAGCCGTTAACAGCAATGCCGGCGGCGTGGCACTA
TCCACGGTAGTGCGTATTTACCAGCTCAAAGACCGCAAAACATTCGACACGACGGACTACCTGTCACTGT
TTAAAGCTGACAGCCAGGCTATTAAAGCAGACCTGCTAGCTGAGAAAGATATCCGCCTGCAGCCGGGCGG
GGCGGTGACGGTCGATATACCGATGGAGGACAGTGCGCAGTATGTGGCGGTGGCCGGGATGTTTATGTCA
CCGGACCAGGAGAACAACACCTGGCGGGTAGTGCTGAGTAGTGACGACCTTGACCCGGATAAAGCCCGGG
TGATTGAGGCCGGTAATAACCAACTAACGCTAAAGGCGCTGAAAGATGAGTGA