SecReT6
Protein ID: 161504600
SecReT6 ID238
T6SS typei2
Gene symbol-
Locus tagSARI_02714
StrainSalmonella enterica subsp. arizonae serovar 62:z4,z23:- str. RSK2980
Repliconchromosome [GenBank: NC_010067] [Browse all T6SS(s) in this replicon]
Location [Strand]2622805..2623908 [-]
Producthypothetical protein
NoteTssG
UniProt IDA9MNT8
KEGG IDses:SARI_02714
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 6.10E-80, Aligned region: 25..326
Protein Sequence: 367 a.a.     [Download]
>gi|161504600|ref|YP_001571712.1| hypothetical protein SARI_02714 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
MHPVEREPQSAPARLIAQLGNRLPYINFYRFCQLLEQIQPDKPVTGSTWQVRYEPVRFRPHPGMGFPASE
IKGAEPPEHPHLPPTVRITFMGLYGVESPLPTHYIDDITQRREGYEATVDFLDIFNHRLITQYYRIWRKY
SYPATFEEGGKDKTSQYLLGLAGLGIDGCTDSIATPASRFLALLPVMLLPGRTAEGMASLVRLLAPNTQA
KIWHHDKRRVPLKSPLTMSVRQPVTLTNRPVMGNYATDANSQVLMRLTTSDPTEVQGWLPGGELHGDLMA
LLHVYLGSRLNVRLQLCVDRSLLPDATMSAKPEAGAVQLGRTAVMRPLNSANTATHPKTITINLGRYERV
QENIHRRETDEDGDYRW
 
Nucleotide Sequence: 1104 bp     [Download]
>ref|NC_010067.1|:c2623908-2622805 hypothetical protein SARI_02714 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
ATGCATCCGGTGGAAAGAGAACCACAGTCCGCGCCTGCCCGGCTGATAGCACAGCTGGGCAACCGGCTGC
CTTACATAAATTTTTACCGCTTCTGCCAGTTGCTGGAGCAGATCCAGCCGGACAAACCGGTCACCGGCAG
CACCTGGCAGGTGCGATATGAGCCGGTACGCTTCCGCCCCCATCCGGGGATGGGGTTCCCGGCCTCTGAA
ATCAAAGGGGCGGAGCCACCTGAACATCCGCACCTGCCACCGACGGTCCGCATCACGTTTATGGGGCTCT
ACGGCGTGGAGTCTCCACTGCCGACGCACTATATCGATGACATCACCCAGCGGCGGGAAGGGTATGAAGC
CACAGTCGATTTTCTTGATATCTTCAACCACCGGCTGATTACCCAGTACTACCGCATCTGGCGTAAATAC
TCATACCCTGCGACCTTTGAGGAAGGGGGAAAAGACAAAACCTCGCAGTATCTGCTGGGGCTGGCCGGGC
TCGGAATTGACGGCTGCACGGACAGTATCGCGACTCCGGCGTCCCGCTTTCTGGCGCTGTTGCCGGTGAT
GTTGTTGCCGGGGCGAACCGCAGAAGGTATGGCCTCGCTGGTGCGTCTGCTGGCACCCAACACGCAGGCG
AAGATCTGGCACCACGACAAACGCCGTGTGCCGCTGAAGAGCCCCCTGACCATGAGTGTGCGTCAGCCTG
TCACCCTGACAAACCGTCCGGTGATGGGCAATTATGCCACTGACGCGAACAGCCAGGTACTGATGCGTCT
GACCACCTCCGACCCTACGGAAGTACAGGGCTGGCTGCCCGGCGGTGAACTGCACGGTGACTTAATGGCG
CTGCTGCATGTGTATCTTGGGTCACGGCTTAATGTGCGTCTGCAGCTGTGTGTCGACCGTAGCCTGCTGC
CGGACGCGACAATGAGCGCTAAGCCTGAAGCTGGCGCAGTGCAACTGGGTCGTACAGCCGTGATGCGACC
GCTGAACTCGGCGAATACTGCCACTCACCCCAAAACCATAACCATCAATCTTGGCCGCTATGAGCGGGTA
CAGGAAAATATTCACCGCAGGGAGACCGATGAAGATGGCGATTACCGCTGGTAA