SecReT6
Protein ID: 161504601
SecReT6 ID238
T6SS typei2
Gene symbol-
Locus tagSARI_02715
StrainSalmonella enterica subsp. arizonae serovar 62:z4,z23:- str. RSK2980
Repliconchromosome [GenBank: NC_010067] [Browse all T6SS(s) in this replicon]
Location [Strand]2623863..2625626 [-]
Producthypothetical protein
NoteTssF
UniProt IDA9MNT9
KEGG IDses:SARI_02715
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 1.60E-181, Aligned region: 6..582
Protein Sequence: 587 a.a.     [Download]
>gi|161504601|ref|YP_001571713.1| hypothetical protein SARI_02715 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
MEDLTLRYFDAEMRYLREAAKEFAQTHPDRAAMLDLDKAGTPDPYVERLLEGFAFSMGRLREKIDDDLPE
LTEGLVSMLWPHYLRTIPSLSVVALTPALHAMKMAEVVPAGLEMYSRPVGPKNTVCRYRTTRDVMLNPLG
VSDITMTTEPDGRSLLRMRFACSSQADWSGADLSRLSLYLGADAPVSSQLHLMLTKRQAALYMRLPGQPD
RIQLDGYFSPGGFAEEDGLWPKGDTAFSGYQLLLEYFTFRDKFMFVHLNGLEGITPPHGTEYFDIEVVFS
TPWPSDLPVADDAVRLHCVPVINLFTLEADPLTISGLESEYLLRPKRLQDGHTEIYSVDSVTGSNRTSDA
EYVPFSSFRHKGGMMRRHAPPRYYHTRIKRGVTGLYDTWLILGGHQWEEDRKFEREAVSLQITGTNGQLP
RRALQSTLLDRCEQVVSTSLTVRNLCKPTLPVYPPAEDRFHWRVLSHLGSGFLNMMSTAEVLRGTLALYN
WQEDELNTRRLEAIQQVAHHRLQRFEQGYLLRGLDIEVTLDSNGFTGEGDIHLFGEMLNRFFALYADMNQ
FNQLTLIVQPEGKCIRWKENHSPRLPG
 
Nucleotide Sequence: 1764 bp     [Download]
>ref|NC_010067.1|:c2625626-2623863 hypothetical protein SARI_02715 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
ATGGAAGATTTAACCCTGCGCTATTTCGATGCAGAAATGCGCTACCTGCGTGAAGCCGCGAAAGAGTTCG
CGCAAACCCATCCCGATCGCGCGGCGATGCTCGACCTGGATAAGGCCGGCACACCCGATCCGTATGTTGA
ACGCCTGCTTGAAGGGTTTGCCTTCTCAATGGGGCGGCTGCGCGAAAAGATTGACGACGACCTGCCGGAA
CTGACTGAAGGTCTGGTCAGCATGCTCTGGCCACACTACCTGCGAACTATTCCGTCCCTCTCGGTGGTGG
CGCTGACCCCGGCGCTGCATGCCATGAAAATGGCGGAAGTGGTGCCCGCAGGCCTTGAGATGTATTCCCG
TCCGGTAGGGCCGAAGAACACAGTCTGTCGTTACCGTACCACCCGGGATGTGATGCTTAATCCCCTGGGG
GTTTCGGACATTACCATGACCACTGAGCCTGACGGTCGTTCGCTGTTACGGATGCGTTTTGCCTGCAGCA
GCCAGGCAGACTGGTCCGGTGCAGATCTCAGCCGTCTGAGCCTGTATCTCGGGGCGGATGCGCCGGTCAG
CAGCCAGCTGCATCTTATGCTGACCAAAAGACAGGCCGCGCTGTACATGCGCCTGCCTGGCCAGCCCGAC
CGTATTCAGCTTGACGGGTATTTCTCACCGGGAGGATTTGCTGAAGAGGACGGTCTGTGGCCGAAAGGCG
ATACCGCCTTCAGCGGCTACCAGCTGCTGCTGGAGTACTTCACCTTCCGCGACAAGTTTATGTTTGTTCA
CCTTAACGGTCTGGAGGGGATCACACCACCACACGGTACGGAGTACTTTGATATTGAAGTCGTATTCAGC
ACGCCGTGGCCATCAGACCTGCCGGTCGCCGATGACGCGGTTCGTCTGCACTGTGTACCGGTAATTAATC
TGTTCACGCTGGAAGCGGACCCGCTCACTATTTCTGGTCTTGAAAGCGAATACCTGCTGCGTCCTAAACG
TCTGCAGGATGGGCATACTGAGATTTACTCCGTAGATTCGGTAACCGGCTCAAACCGGACCAGTGACGCG
GAGTATGTGCCTTTCAGCAGCTTCCGCCACAAGGGAGGGATGATGCGCCGTCATGCGCCACCCCGCTATT
ACCACACCCGCATTAAGCGGGGTGTCACCGGGCTGTATGACACCTGGCTGATTCTGGGGGGGCACCAGTG
GGAAGAGGACCGGAAGTTTGAACGCGAAGCCGTGTCGTTGCAAATCACCGGCACCAATGGACAGTTACCG
CGCCGGGCGCTGCAGAGCACACTACTCGACCGCTGTGAACAGGTAGTCAGTACATCACTGACGGTGCGCA
ACCTCTGCAAACCGACGCTGCCGGTTTACCCGCCTGCGGAAGACCGTTTCCACTGGCGGGTGCTGAGCCA
CCTGGGCTCCGGGTTCCTGAACATGATGAGCACCGCCGAAGTGCTGCGCGGGACGCTGGCTCTCTATAAC
TGGCAGGAAGATGAACTGAACACCCGGCGTCTGGAGGCGATTCAGCAGGTGGCGCATCACCGCCTGCAAC
GTTTTGAACAGGGTTACCTGCTGCGGGGGCTGGATATCGAAGTAACCCTCGACAGCAACGGGTTTACGGG
GGAGGGCGATATCCACCTGTTCGGCGAAATGCTCAACCGTTTCTTTGCGCTCTATGCTGACATGAATCAG
TTTAACCAGCTCACCCTCATCGTTCAGCCAGAAGGAAAATGCATCCGGTGGAAAGAGAACCACAGTCCGC
GCCTGCCCGGCTGA