SecReT6
Protein ID: 161504605
SecReT6 ID238
T6SS typei2
Gene symbol-
Locus tagSARI_02719
StrainSalmonella enterica subsp. arizonae serovar 62:z4,z23:- str. RSK2980
Repliconchromosome [GenBank: NC_010067] [Browse all T6SS(s) in this replicon]
Location [Strand]2627615..2628598 [-]
Producthypothetical protein
NoteTssA
UniProt IDNA
KEGG IDNA
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.40E-23, Aligned region: 66..127
ImpA-rel_N [PF06812], Evalue: 1.40E-23, Aligned region: 163..182
Protein Sequence: 327 a.a.     [Download]
>gi|161504605|ref|YP_001571717.1| hypothetical protein SARI_02719 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
MSTLNTLLNACQTEQVPLLAATRERVAQWDNWLQPLSGSSPAGEDPGYDDDFQQMREEVNKLSGADTELI
CRLAEKLLTTTAKDIRVVTYYCWAKLHREGEQGLAEGLELLAGLLERFGTQLHPQRDRSRKAALEWLAGS
RMIDSLSLYPEVVRIDAMRTTGALLLIAQLTEDEPDEIRPELNALYGALESRLQKAGGVDAVVPQNASTS
ETPSAADHSDAPAIGRITSGQDLLAQARTLTEYLREQPDGWLSAHHLMKSLRHDTLRAIPAPDAQGRTRI
EPPRADQRALLKRLYLQQNWAEMLDAADSTFSRGANHLWLDLQWYIH
 
Nucleotide Sequence: 984 bp     [Download]
>ref|NC_010067.1|:c2628598-2627615 hypothetical protein SARI_02719 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
ATGAGCACCCTTAATACTTTGCTGAACGCCTGCCAGACTGAGCAGGTGCCACTGCTTGCGGCGACCCGTG
AGCGCGTGGCGCAGTGGGATAACTGGCTGCAGCCGCTGTCCGGTTCATCGCCCGCTGGTGAAGATCCGGG
CTATGATGATGACTTCCAGCAGATGCGCGAGGAGGTCAACAAGCTCTCCGGAGCAGACACAGAGCTTATC
TGTCGGCTGGCTGAAAAGCTGCTGACTACCACCGCCAAAGACATTCGCGTCGTGACGTACTACTGCTGGG
CGAAACTGCACCGGGAAGGCGAGCAGGGGCTGGCCGAAGGACTCGAACTGCTGGCCGGTCTACTGGAGCG
CTTTGGTACACAACTGCACCCGCAGCGTGACCGCAGCCGTAAGGCGGCGCTGGAATGGCTGGCGGGTTCG
CGTATGATCGATTCGCTCTCCCTGTACCCGGAAGTGGTCAGGATCGATGCGATGCGCACCACAGGGGCGC
TGTTGCTGATTGCGCAGCTTACCGAAGATGAGCCGGATGAAATACGCCCTGAGCTGAACGCGCTATACGG
CGCCCTGGAAAGCCGTCTGCAGAAAGCGGGTGGTGTGGATGCGGTCGTGCCGCAGAACGCCAGTACCAGC
GAAACACCTTCCGCGGCAGACCACAGCGATGCCCCGGCAATCGGGCGAATCACTTCCGGCCAGGATTTGC
TGGCACAGGCCCGCACCCTCACTGAATACCTGCGCGAGCAGCCCGACGGCTGGCTGTCAGCGCACCATCT
GATGAAGAGTCTGCGGCACGATACCCTACGGGCCATTCCCGCGCCGGATGCACAGGGGCGTACTCGTATC
GAACCGCCAAGAGCAGACCAGCGCGCGTTGCTCAAACGTTTGTATCTGCAACAGAACTGGGCTGAAATGC
TGGACGCGGCCGACAGCACCTTTTCCCGCGGTGCCAATCACCTGTGGCTGGATTTGCAGTGGTATATCCA
CTAG