SecReT6
Protein ID: 161504610
SecReT6 ID238
T6SS typei2
Gene symbol-
Locus tagSARI_02724
StrainSalmonella enterica subsp. arizonae serovar 62:z4,z23:- str. RSK2980
Repliconchromosome [GenBank: NC_010067] [Browse all T6SS(s) in this replicon]
Location [Strand]2636579..2639092 [-]
Producthypothetical protein
NoteTssI
UniProt IDA9MNU8
KEGG IDses:SARI_02724
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 9.70E-61, Aligned region: 42..363
DUF2345 [PF10106], Evalue: 6.70E-48, Aligned region: 616..768
T6SS_Vgr [PF13296], Evalue: 2.10E-31, Aligned region: 495..601
Phage_base_V [PF04717], Evalue: 3.40E-15, Aligned region: 409..488
Sarcoglycan_1 [PF04790], Evalue: 0.00095, Aligned region: 628..661
Sarcoglycan_1 [PF04790], Evalue: 0.00095, Aligned region: 687..736
Protein Sequence: 837 a.a.     [Download]
>gi|161504610|ref|YP_001571722.1| hypothetical protein SARI_02724 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
MSLTDTLKNTLSALTEGGLNRYRLDIPSCTASLDVEEFNGREFMSELYYYEVIFTSSDQNISSAQLLTRP
ATLTMGTGPLMGLTGQKVVHGVVTHFKRISGSRDQATYQIIIEPFLSLLRKQFRTHRFFVNKSVPEVVTE
VLQEHGLKGWEYEFTLKADYPKREQINQYKENDLAFIERLLAEVGIFYFFTLQPDTQTEVVHFADKQSAW
TFGKSLPLSSPSGMSDNAADSVWGVNVRQNVVERSVIASDYNHREAQNILTSVPADMTRGDGDGVTYGEV
YHYLPRHLERGDKIAPSAETGNFWARLEHERFLSVQTTISGCSNDALLFPAQVLTISERVVPPTLPSETD
NGIIITRTGYIASRKDALIVMWEGMPYYENRCWRPAAKKRPVVSGTLMARVTSAKENDIYAWQDASGMYR
VKFDADRDDKRQGMESMPVRFAKPYGGDKYGFHFPLIQGTEVAIAFHEGDPDRPYIAHAMHDSRHVDHVT
ELNSTRNVIRTAGLNKLRMEDKRGEEHVKLSTEYGGKTQLNLGHNVDAYRDLRGEGAELRTDRHVSIRGG
AGVFITADKQPFAGDKMLSMREAISQLENALSIARSLSDAAETAEALPADIQSQVKLTESLKELARPGMV
LNAPEGVSITSPQAVRMASGSASVGIISQQNTDISALKRFTVAAGEAVSMLARKAGMKLFAAKGKVEIQA
QDDALEAIAKKDVTVTSTEGRIEITAAKDIVLKNLDGSFIQITGKNIILGCEGNVLWKCANAQKMGTANY
TSSVPEFPGGYSEYFVAHDEKTGQLAPNTRYRITTSKGDVFSGITDSDGNTAEIFTALSDKIKVELG
 
Nucleotide Sequence: 2514 bp     [Download]
>ref|NC_010067.1|:c2639092-2636579 hypothetical protein SARI_02724 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
ATGAGTCTGACAGATACGCTTAAGAACACCCTGTCTGCGCTAACTGAAGGCGGACTGAACCGCTACCGCC
TCGATATTCCGTCCTGCACAGCTTCACTGGATGTGGAAGAGTTTAACGGTAGGGAGTTCATGAGTGAGCT
CTACTACTACGAAGTTATCTTTACCAGCAGCGACCAGAATATCAGTTCAGCGCAACTGTTGACCAGGCCT
GCCACGCTGACCATGGGAACCGGGCCACTGATGGGGCTGACTGGGCAGAAAGTGGTGCATGGTGTGGTGA
CGCATTTTAAGCGTATCAGTGGTTCACGTGACCAGGCGACGTACCAGATTATTATTGAGCCATTCCTGTC
TTTGCTGCGCAAGCAATTCCGTACCCACCGCTTTTTTGTCAATAAGTCTGTACCGGAAGTCGTCACCGAG
GTGCTGCAGGAACATGGCCTGAAAGGCTGGGAATATGAGTTCACTCTCAAAGCTGACTATCCGAAGCGTG
AACAGATTAATCAGTACAAGGAAAATGACCTCGCCTTCATTGAGCGTCTGCTGGCTGAAGTAGGGATTTT
TTACTTCTTCACTTTACAGCCCGATACCCAGACCGAAGTGGTGCACTTTGCGGATAAGCAAAGTGCCTGG
ACATTCGGAAAATCGCTGCCGCTCAGCAGCCCATCGGGAATGAGTGATAATGCTGCGGACTCGGTGTGGG
GTGTTAACGTCCGGCAGAACGTGGTTGAGCGCTCTGTCATCGCCAGTGATTACAACCACCGTGAAGCCCA
GAATATCCTGACCTCTGTACCGGCGGACATGACCCGTGGCGACGGTGACGGTGTTACCTATGGTGAAGTT
TATCACTACCTGCCGCGTCATCTTGAACGCGGCGACAAAATCGCACCGTCAGCGGAAACTGGCAACTTCT
GGGCACGCCTTGAACATGAGCGTTTTCTGTCTGTACAGACGACCATCAGCGGGTGCAGCAATGATGCCCT
GCTTTTTCCGGCCCAGGTGCTGACCATCAGTGAACGTGTGGTACCGCCGACACTGCCATCAGAAACGGAC
AACGGCATTATCATTACCCGCACGGGCTATATCGCCAGTCGTAAAGATGCCCTGATCGTGATGTGGGAGG
GGATGCCGTATTACGAGAACCGATGCTGGCGTCCTGCTGCTAAAAAGCGCCCGGTGGTCAGCGGTACCCT
GATGGCCCGCGTCACCAGCGCCAAGGAGAACGATATTTACGCCTGGCAGGATGCATCCGGCATGTACCGG
GTGAAGTTTGATGCCGACCGTGACGATAAACGTCAGGGCATGGAAAGTATGCCGGTGCGCTTCGCCAAGC
CTTACGGGGGAGACAAGTACGGCTTCCACTTCCCGCTGATACAGGGTACTGAAGTTGCCATTGCGTTCCA
TGAAGGTGACCCGGACCGGCCGTATATCGCCCATGCCATGCACGACTCCCGCCATGTTGACCATGTCACG
GAGCTGAACAGCACGCGTAATGTTATCCGCACAGCGGGTCTGAACAAGCTGCGGATGGAAGACAAACGCG
GCGAAGAGCACGTTAAACTCAGTACGGAGTACGGGGGTAAGACGCAGCTTAATTTAGGGCACAATGTAGA
CGCTTACAGGGATCTTCGTGGTGAGGGGGCAGAACTGCGCACCGACCGGCATGTTTCCATTCGTGGTGGT
GCCGGGGTGTTCATTACCGCCGATAAACAGCCGTTTGCCGGCGATAAGATGCTGTCGATGCGGGAAGCGA
TATCTCAACTGGAAAATGCATTGAGTATTGCCAGAAGTCTTTCTGATGCTGCTGAAACGGCAGAGGCATT
GCCAGCAGATATCCAGAGCCAGGTTAAGCTGACGGAGTCCCTGAAAGAGCTGGCCCGGCCAGGTATGGTG
CTGAATGCGCCGGAAGGGGTGAGTATCACCAGCCCGCAGGCAGTTCGTATGGCATCGGGGAGTGCAAGCG
TCGGGATTATATCCCAGCAGAATACGGACATCAGTGCGCTGAAGCGCTTTACGGTGGCGGCGGGTGAAGC
CGTGAGCATGCTGGCCCGAAAGGCCGGGATGAAACTCTTTGCGGCTAAGGGCAAAGTGGAAATCCAGGCG
CAGGATGATGCGCTGGAGGCCATTGCCAAAAAGGATGTCACGGTGACCAGTACGGAAGGACGGATTGAGA
TCACTGCGGCGAAAGATATAGTGCTGAAAAACCTGGATGGCTCATTTATCCAGATAACGGGTAAGAACAT
CATACTTGGCTGTGAAGGTAATGTGCTGTGGAAATGTGCTAATGCGCAGAAAATGGGAACCGCAAACTAT
ACCTCTTCTGTACCGGAATTTCCCGGTGGATACAGTGAATATTTTGTTGCGCATGACGAAAAAACAGGAC
AGCTTGCTCCGAATACGCGCTATCGCATTACGACCAGTAAAGGCGATGTTTTTTCCGGCATAACGGATTC
AGACGGGAATACTGCCGAAATATTCACGGCTTTATCTGACAAGATCAAAGTTGAACTTGGATAA