SecReT6
Protein ID: 161504614
SecReT6 ID238
T6SS typei2
Gene symbol-
Locus tagSARI_02728
StrainSalmonella enterica subsp. arizonae serovar 62:z4,z23:- str. RSK2980
Repliconchromosome [GenBank: NC_010067] [Browse all T6SS(s) in this replicon]
Location [Strand]2640439..2643033 [-]
Producthypothetical protein
NoteTssH
UniProt IDA9MNV2
KEGG IDses:SARI_02728
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 1.20E-40, Aligned region: 218..237
AAA_2 [PF07724], Evalue: 1.20E-40, Aligned region: 592..757
AAA [PF00004], Evalue: 1.80E-19, Aligned region: 220..332
AAA [PF00004], Evalue: 1.80E-19, Aligned region: 597..719
AAA [PF00004], Evalue: 1.80E-19, Aligned region: 745..762
AAA_16 [PF13191], Evalue: 6.80E-15, Aligned region: 110..183
AAA_16 [PF13191], Evalue: 6.80E-15, Aligned region: 197..242
AAA_16 [PF13191], Evalue: 6.80E-15, Aligned region: 265..298
AAA_16 [PF13191], Evalue: 6.80E-15, Aligned region: 422..495
AAA_16 [PF13191], Evalue: 6.80E-15, Aligned region: 566..632
AAA_16 [PF13191], Evalue: 6.80E-15, Aligned region: 660..690
AAA_16 [PF13191], Evalue: 6.80E-15, Aligned region: 735..788
ClpB_D2-small [PF10431], Evalue: 3.30E-14, Aligned region: 365..389
ClpB_D2-small [PF10431], Evalue: 3.30E-14, Aligned region: 763..838
AAA_5 [PF07728], Evalue: 3.70E-14, Aligned region: 220..240
AAA_5 [PF07728], Evalue: 3.70E-14, Aligned region: 318..350
AAA_5 [PF07728], Evalue: 3.70E-14, Aligned region: 596..717
AAA_22 [PF13401], Evalue: 4.40E-09, Aligned region: 219..305
AAA_22 [PF13401], Evalue: 4.40E-09, Aligned region: 341..384
AAA_22 [PF13401], Evalue: 4.40E-09, Aligned region: 593..632
AAA_25 [PF13481], Evalue: 1.90E-07, Aligned region: 220..244
AAA_25 [PF13481], Evalue: 1.90E-07, Aligned region: 275..307
AAA_25 [PF13481], Evalue: 1.90E-07, Aligned region: 592..625
Arch_ATPase [PF01637], Evalue: 8.70E-07, Aligned region: 198..235
Arch_ATPase [PF01637], Evalue: 8.70E-07, Aligned region: 272..370
Arch_ATPase [PF01637], Evalue: 8.70E-07, Aligned region: 589..611
Arch_ATPase [PF01637], Evalue: 8.70E-07, Aligned region: 666..678
IstB_IS21 [PF01695], Evalue: 2.30E-06, Aligned region: 214..243
IstB_IS21 [PF01695], Evalue: 2.30E-06, Aligned region: 596..614
NACHT [PF05729], Evalue: 8.10E-06, Aligned region: 220..249
NACHT [PF05729], Evalue: 8.10E-06, Aligned region: 596..615
Zeta_toxin [PF06414], Evalue: 1.10E-05, Aligned region: 214..244
Zeta_toxin [PF06414], Evalue: 1.10E-05, Aligned region: 583..636
Sigma54_activat [PF00158], Evalue: 2.40E-05, Aligned region: 204..234
Sigma54_activat [PF00158], Evalue: 2.40E-05, Aligned region: 595..713
AAA_17 [PF13207], Evalue: 3.50E-05, Aligned region: 220..283
AAA_17 [PF13207], Evalue: 3.50E-05, Aligned region: 595..631
AAA_19 [PF13245], Evalue: 5.30E-05, Aligned region: 217..243
AAA_19 [PF13245], Evalue: 5.30E-05, Aligned region: 592..614
AAA_29 [PF13555], Evalue: 0.0001, Aligned region: 214..236
AAA_29 [PF13555], Evalue: 0.0001, Aligned region: 592..622
AAA_14 [PF13173], Evalue: 0.00017, Aligned region: 220..310
AAA_14 [PF13173], Evalue: 0.00017, Aligned region: 594..678
Clp_N [PF02861], Evalue: 0.00032, Aligned region: 4..47
Clp_N [PF02861], Evalue: 0.00032, Aligned region: 89..101
AAA_23 [PF13476], Evalue: 0.00093, Aligned region: 220..237
AAA_23 [PF13476], Evalue: 0.00093, Aligned region: 372..515
AAA_23 [PF13476], Evalue: 0.00093, Aligned region: 593..620
DUF258 [PF03193], Evalue: 0.0018, Aligned region: 206..237
DUF258 [PF03193], Evalue: 0.0018, Aligned region: 594..608
SRP54 [PF00448], Evalue: 0.0031, Aligned region: 220..242
SRP54 [PF00448], Evalue: 0.0031, Aligned region: 595..626
RNA_helicase [PF00910], Evalue: 0.0032, Aligned region: 221..242
RNA_helicase [PF00910], Evalue: 0.0032, Aligned region: 597..617
RNA_helicase [PF00910], Evalue: 0.0032, Aligned region: 694..715
AAA_18 [PF13238], Evalue: 0.0037, Aligned region: 220..240
AAA_18 [PF13238], Evalue: 0.0037, Aligned region: 597..616
AAA_28 [PF13521], Evalue: 0.0055, Aligned region: 220..266
AAA_28 [PF13521], Evalue: 0.0055, Aligned region: 596..615
Protein Sequence: 864 a.a.     [Download]
>gi|161504614|ref|YP_001571726.1| hypothetical protein SARI_02728 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
MEGAASLCQTRAHAEILPEHWLLKLLEQGEGDLTVLARRYEWDIDALWQDLLGWLDSLPRSVRSRPQLSD
SIQTLMQEAWLIASLNSEEQIRSHHLLMALVGKQNLVRCDGLWPLLTLGQSQLGRLRPLLDVQSDERPEV
QLEKELAQSHGGEVVFVGRPAGAELKDGELNPALQNALDKFTLDVTAKAKEGKIDPVFGRDTEIRQMVDI
LSRRRKNNPILVGEPGVGKTALVEGLALRIAEGNVPESLRPVVLRTLDLGLLQAGAGVKGEFEQRLKNVI
DAVQHSPAPILLFIDEAHTIIGAGNSAGGADAANLLKPALARGELRTIAATTWSEYKQYFERDAALERRF
QMVKVDEPDDDTACLMLRGLKSRYAEHHNVHITDDAVKAAVTLSRRYLTGRQLPDKAVDLLDTAATRVRM
SLDTVPEQLTRIRSQITSLEMEKQALLEDIAVGNQIHGERLSGIEQEEVRLIVELDDLESRYGQELKLTE
QLLECRQDISRQSETHALQQELNGMQDGNPLLSVDVDVRTVATVIADWTGVPLSSLMKDEQTELLILENE
IGKRVVGQEVALAAIAQRLRAAKTGLTSENGPQGVFLLVGPSGVGKTKTALALADVMYGGEKSLITINLS
EYQEPHTVSQLKGSPPGYVGYGQGGILTEAVRKRPYSVVLLDEVEKAHRDVMNLFYQVFDRGFMRDGEGR
EIDFRNTVILMTSNLGSDHLMQLLAEQPEATEADLHELLRPILRDHFQPALLARFQTVIYRPLAETAMRT
IVEMKLAQVSKRLHRHYGLTTKIDESLYDALTAACLLPDTGARNVDSLLNQQILPVLSQQLLTYMVAKQK
PTLLTLGWSDEEGIGLEFSGAAER
 
Nucleotide Sequence: 2595 bp     [Download]
>ref|NC_010067.1|:c2643033-2640439 hypothetical protein SARI_02728 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
ATGGAAGGGGCGGCCTCGCTCTGCCAGACCCGCGCCCATGCGGAAATTCTGCCTGAGCACTGGCTGCTGA
AACTGCTCGAACAGGGAGAAGGTGACCTGACGGTGCTGGCGCGCCGTTATGAGTGGGATATAGATGCGCT
GTGGCAGGATTTGCTCGGCTGGCTGGATTCACTTCCCCGCTCTGTTCGCAGTCGCCCGCAGCTTTCAGAC
AGCATTCAGACGCTGATGCAGGAAGCCTGGCTGATTGCTTCGCTCAACAGTGAAGAGCAGATCCGCAGTC
ATCATCTGCTGATGGCCTTGGTCGGGAAACAAAATCTGGTGCGCTGTGATGGTCTGTGGCCGCTGCTGAC
GCTCGGTCAGAGCCAACTGGGGCGTCTGCGACCACTGCTCGATGTGCAGTCAGATGAGCGTCCGGAAGTG
CAACTGGAGAAGGAACTGGCGCAGAGCCACGGTGGAGAGGTGGTGTTTGTTGGCCGCCCTGCAGGTGCAG
AACTTAAAGACGGTGAGCTGAACCCGGCGCTACAGAACGCGCTGGATAAGTTCACTCTCGACGTTACCGC
CAAAGCGAAGGAAGGCAAAATCGACCCGGTATTTGGTCGCGATACTGAGATCCGTCAGATGGTGGATATC
CTCTCCCGCCGCCGCAAGAACAACCCGATTCTGGTCGGTGAGCCGGGTGTCGGCAAAACGGCGCTGGTGG
AAGGGCTGGCATTACGAATTGCCGAGGGCAACGTGCCGGAATCCCTCAGACCTGTTGTTCTGCGTACCCT
CGACCTCGGTCTGCTGCAGGCGGGGGCGGGCGTGAAAGGGGAATTCGAACAGCGCCTTAAAAACGTGATT
GATGCCGTACAGCACTCGCCGGCCCCCATTCTGCTGTTTATCGACGAAGCACACACCATTATCGGTGCGG
GAAATTCAGCTGGTGGCGCGGATGCGGCCAACCTGCTGAAACCTGCCCTGGCCCGTGGTGAACTGCGCAC
TATTGCCGCGACCACCTGGTCCGAATATAAGCAGTATTTTGAGCGGGATGCCGCGCTGGAGCGCCGCTTC
CAGATGGTGAAGGTCGACGAACCGGATGACGACACCGCCTGCCTGATGCTCAGAGGCCTGAAATCACGCT
ACGCCGAACACCATAACGTGCATATCACTGACGATGCGGTCAAAGCCGCTGTCACCCTGTCGCGCCGCTA
CCTGACGGGCCGCCAGCTGCCGGATAAGGCCGTCGATTTACTCGACACCGCCGCTACCCGCGTGCGTATG
AGCCTCGATACCGTACCCGAACAGTTGACCCGCATCCGCTCGCAGATTACCTCCCTTGAAATGGAGAAGC
AGGCGCTGCTGGAAGATATTGCCGTTGGCAATCAGATCCACGGCGAACGCCTGAGCGGGATTGAACAGGA
GGAGGTACGCCTGATAGTCGAACTCGATGATCTGGAATCCCGGTATGGTCAGGAGCTGAAACTTACTGAA
CAGTTACTGGAATGCCGCCAGGACATCTCTCGCCAGAGTGAGACTCACGCGCTGCAACAGGAGCTGAACG
GCATGCAGGACGGCAACCCATTGCTCTCCGTTGATGTGGACGTGCGCACCGTCGCCACTGTCATTGCCGA
CTGGACGGGCGTGCCACTGTCTTCCCTGATGAAAGATGAACAGACCGAACTGCTGATTCTGGAAAACGAA
ATCGGCAAACGGGTTGTGGGTCAGGAAGTGGCGCTTGCAGCCATTGCTCAGCGTCTGCGTGCGGCGAAAA
CCGGCCTCACTTCCGAGAACGGTCCGCAGGGCGTGTTCCTGCTGGTTGGCCCGAGCGGCGTGGGTAAAAC
CAAGACCGCGCTGGCGCTGGCCGATGTAATGTACGGTGGTGAAAAATCCCTTATCACGATTAACCTCTCG
GAATACCAGGAGCCGCACACGGTGTCGCAGCTGAAAGGTTCACCGCCGGGTTACGTTGGTTATGGCCAGG
GCGGCATTCTCACCGAAGCGGTACGCAAGCGTCCGTACAGCGTGGTGCTGCTCGATGAAGTGGAGAAAGC
GCACCGCGACGTCATGAACCTGTTCTATCAGGTGTTCGACCGCGGCTTTATGCGCGACGGCGAAGGACGT
GAAATCGACTTCCGTAACACCGTTATTCTGATGACCTCCAACCTCGGCAGCGACCACCTGATGCAGTTGC
TCGCTGAGCAGCCGGAAGCCACTGAAGCCGACCTGCACGAACTGCTGCGCCCGATTTTACGCGACCACTT
CCAGCCGGCGCTGCTGGCCCGTTTCCAGACCGTGATTTATCGTCCGTTAGCAGAGACCGCCATGCGCACC
ATCGTGGAAATGAAGCTCGCTCAGGTGAGTAAGCGTCTGCACCGTCACTACGGCCTGACCACCAAAATTG
ACGAAAGCCTGTATGACGCGCTGACTGCCGCCTGCCTGCTGCCGGATACCGGTGCGCGTAACGTTGACAG
CCTGCTCAATCAGCAGATTCTACCGGTGCTGAGTCAGCAGCTTTTAACGTACATGGTGGCGAAACAGAAA
CCGACTTTACTGACGCTGGGGTGGAGTGATGAAGAAGGGATTGGGCTTGAATTTTCAGGTGCGGCTGAAC
GTTAA