SecReT6
Protein ID: 161504615
SecReT6 ID238
T6SS typei2
Gene symbol-
Locus tagSARI_02729
StrainSalmonella enterica subsp. arizonae serovar 62:z4,z23:- str. RSK2980
Repliconchromosome [GenBank: NC_010067] [Browse all T6SS(s) in this replicon]
Location [Strand]2643250..2643756 [-]
Producthypothetical protein
NoteTssD
UniProt IDA9MPE2
KEGG IDses:SARI_02729
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 3.90E-37, Aligned region: 11..152
Protein Sequence: 168 a.a.     [Download]
>gi|161504615|ref|YP_001571727.1| hypothetical protein SARI_02729 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
MESNSMAIPVYLWLKDDGGADIKGSVDVQDREGSIEVVAQEHNLYIPTDNNTGKLTGTRIHSPFLFTKEI
DSSSPYLYKAVTTGQTLKSAEFKWYKINDAGQEVEYFNTKLENVKVVKVNPVMHDIKDPSFEKHNHLEKI
ELRYEKITWTYKDGNIIHSDSWNERATA
 
Nucleotide Sequence: 507 bp     [Download]
>ref|NC_010067.1|:c2643756-2643250 hypothetical protein SARI_02729 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
ATGGAGAGTAATTCCATGGCAATTCCTGTTTATCTTTGGCTGAAAGACGACGGCGGCGCGGACATTAAAG
GGTCTGTAGACGTTCAGGATCGTGAAGGCAGTATCGAAGTGGTTGCCCAGGAGCACAACCTGTACATCCC
GACTGATAACAATACCGGCAAGCTGACCGGTACCCGTATTCACTCGCCTTTCCTGTTCACCAAGGAAATC
GATTCGTCCAGCCCGTACCTGTACAAGGCGGTGACCACTGGTCAGACCCTCAAGTCTGCGGAATTCAAGT
GGTACAAAATCAACGACGCGGGCCAGGAAGTCGAGTACTTCAACACCAAACTGGAAAACGTGAAGGTGGT
GAAAGTGAATCCGGTGATGCATGACATCAAGGATCCTTCTTTCGAGAAGCATAACCACCTCGAAAAGATC
GAGCTGCGTTACGAAAAAATCACCTGGACCTACAAAGACGGCAACATCATTCATTCCGATTCCTGGAACG
AACGCGCCACCGCGTAA