SecReT6
Protein ID: 161504616
SecReT6 ID238
T6SS typei2
Gene symbol-
Locus tagSARI_02730
StrainSalmonella enterica subsp. arizonae serovar 62:z4,z23:- str. RSK2980
Repliconchromosome [GenBank: NC_010067] [Browse all T6SS(s) in this replicon]
Location [Strand]2643746..2645470 [-]
Producthypothetical protein
NoteTagL
UniProt IDA9MPE3
KEGG IDses:SARI_02730
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 1.50E-18, Aligned region: 52..74
OmpA [PF00691], Evalue: 1.50E-18, Aligned region: 444..540
DUF4381 [PF14316], Evalue: 0.0022, Aligned region: 23..65
DUF4381 [PF14316], Evalue: 0.0022, Aligned region: 328..347
Protein Sequence: 574 a.a.     [Download]
>gi|161504616|ref|YP_001571728.1| hypothetical protein SARI_02730 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
MRDVYRSLLTALAGVLALWLILGFWPLSVGSRVALSLLVILVCGAMLWRQRRASQARATAVREIVDENLP
PEDFQGAVILVCGDNSPLFVSGSRHRETRQGWYLWVKDAEQLPLLAQHLSLVRPALASQISVMLAVVPEQ
HTSGDDFTQSLRSWQRAVVQCRAAFGTIPPLWTVTWVSPSAACVEAEPVWFTTVSQRTGIQVYQPCQGNV
SLTEWTRETGSDGHLSRLSQGLWLDSMLAWQNSAVNDLLSVRQGELPVMKPCVQGMCMVPVSGIAGNLWQ
QHITAVTALPPDAAVTTGPLPLPELLLPALPRRRGVSRRMVSWRYAGLLGGIFLALAMLASWMNNQRLIR
NVGDHLALYHQLTGKPVAPKLRAQQRLRADGTLLDDWARRGEPLCYRLGLYQGLRLVPPVEAAVSDWAPP
PPPPPVIKKIIQGPKTLRLDSMSLFDSGKSALKAGSTRMLVNSLVGIKAKPGWLIVVSGHTDNTGNPKLN
QTLSLKRAEAVRNWMRDTGDVPESCFAVQGYGESRPIATNDTPEGRALNRRVEISLVPQANACQIPGKTP
ASSQDDGASQHNGE
 
Nucleotide Sequence: 1725 bp     [Download]
>ref|NC_010067.1|:c2645470-2643746 hypothetical protein SARI_02730 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
ATGCGTGATGTTTACCGGAGTCTGTTAACCGCCCTGGCGGGCGTACTGGCACTGTGGCTTATCCTGGGCT
TCTGGCCGCTGTCGGTCGGGAGCCGTGTGGCACTCAGCCTGCTGGTCATTCTGGTGTGCGGGGCGATGCT
CTGGCGTCAGCGCCGGGCTTCTCAGGCACGAGCAACCGCTGTCCGGGAAATTGTGGATGAAAATCTGCCG
CCGGAAGATTTTCAGGGTGCGGTGATCCTTGTTTGTGGCGACAACAGCCCACTGTTTGTGTCCGGCTCCC
GTCACCGGGAAACCCGACAGGGCTGGTATCTGTGGGTGAAGGATGCGGAGCAGTTGCCACTCCTGGCACA
ACACCTGAGCCTGGTGCGTCCGGCGCTGGCGTCACAAATCTCCGTCATGCTGGCGGTGGTACCTGAACAG
CACACCTCCGGCGATGATTTTACCCAGTCTCTGCGGAGCTGGCAGCGTGCTGTCGTCCAGTGCCGTGCGG
CATTTGGCACGATCCCCCCGCTGTGGACTGTGACCTGGGTATCGCCGTCGGCGGCCTGTGTGGAGGCTGA
GCCTGTCTGGTTTACCACGGTCAGTCAGCGGACCGGCATTCAGGTATATCAGCCCTGTCAGGGTAATGTG
TCACTGACGGAATGGACCCGGGAAACCGGTTCAGACGGACACCTTTCGCGCCTGAGTCAGGGTCTGTGGC
TGGACAGTATGCTTGCCTGGCAAAACAGCGCGGTGAATGACCTGCTGTCGGTTCGCCAGGGTGAACTGCC
GGTGATGAAGCCCTGCGTGCAGGGTATGTGCATGGTGCCGGTGAGCGGTATCGCGGGCAATCTCTGGCAA
CAGCACATCACCGCTGTGACGGCGCTGCCACCGGATGCCGCCGTAACCACCGGGCCACTGCCGCTGCCTG
AACTGCTGCTGCCGGCGTTACCGCGCCGACGGGGTGTCAGCCGCAGGATGGTGTCCTGGCGTTATGCCGG
ATTACTGGGCGGGATTTTTCTGGCACTGGCCATGCTGGCGTCCTGGATGAATAACCAGCGTCTCATCCGT
AATGTTGGCGATCACCTTGCGTTGTATCACCAGCTGACGGGGAAGCCTGTTGCCCCGAAACTGCGGGCGC
AGCAGCGCCTCAGAGCCGATGGTACATTGCTGGACGACTGGGCGCGTCGCGGGGAGCCACTGTGTTATCG
CCTGGGTCTGTATCAGGGGCTGCGCCTGGTGCCGCCTGTTGAGGCCGCCGTCAGCGACTGGGCACCTCCG
CCACCGCCTCCTCCGGTCATTAAGAAAATCATTCAGGGTCCGAAAACCCTTCGCCTTGACAGCATGTCGC
TGTTCGATTCGGGCAAATCGGCGCTGAAAGCCGGGTCCACCAGAATGCTGGTCAACTCACTGGTCGGTAT
CAAAGCGAAGCCGGGCTGGCTGATTGTGGTGTCAGGTCACACCGACAACACCGGCAACCCAAAACTGAAC
CAGACGCTTTCACTTAAGCGTGCCGAAGCGGTGCGCAACTGGATGCGTGATACCGGTGATGTACCGGAAA
GCTGTTTTGCGGTGCAGGGCTATGGCGAGAGCCGTCCGATCGCAACCAATGACACCCCGGAAGGCCGTGC
GCTGAACCGTCGTGTCGAAATCAGTCTGGTACCGCAGGCCAATGCCTGTCAGATACCCGGCAAAACCCCA
GCGTCATCGCAGGATGATGGCGCATCACAACACAATGGAGAGTAA