SecReT6
Protein ID: 161504617
SecReT6 ID238
T6SS typei2
Gene symbol-
Locus tagSARI_02731
StrainSalmonella enterica subsp. arizonae serovar 62:z4,z23:- str. RSK2980
Repliconchromosome [GenBank: NC_010067] [Browse all T6SS(s) in this replicon]
Location [Strand]2645474..2646124 [-]
Producthypothetical protein
NoteTssL
UniProt IDA9MPE4
KEGG IDses:SARI_02731
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 9.90E-45, Aligned region: 9..204
Protein Sequence: 216 a.a.     [Download]
>gi|161504617|ref|YP_001571729.1| hypothetical protein SARI_02731 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
MNTSEMSQIERTFYPGWLMVSQLRGGQEVRDGEGLYRRACRLVQEVKATLTEAGYSDISRDHMVYALCAL
LDESVLNRGSTDDGYLTWRRDPLQAHFFGTLNAGEELWERIRNLLKETAPDMAVLTCMYRTLQLGFVGQY
RAEDDERREDVVRALGERVPAFTLSQDAPIVARASRLRSGRLYWVSWIIGAAVLVVLWFFLSSSLTELVS
QTVSPG
 
Nucleotide Sequence: 651 bp     [Download]
>ref|NC_010067.1|:c2646124-2645474 hypothetical protein SARI_02731 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
ATGAATACATCAGAAATGAGTCAAATTGAGCGTACGTTCTACCCCGGCTGGCTGATGGTCAGTCAGCTCC
GGGGCGGACAGGAGGTCCGCGACGGGGAAGGGCTCTACCGCCGGGCGTGCCGCCTGGTGCAGGAGGTGAA
AGCCACGCTGACGGAGGCGGGCTACAGCGATATCAGCCGGGATCACATGGTCTATGCGCTGTGTGCCCTG
CTGGATGAGAGCGTCCTGAATCGCGGGTCGACAGATGACGGTTACCTGACGTGGCGGCGCGATCCGCTGC
AGGCGCATTTTTTTGGCACCCTGAATGCCGGTGAAGAACTCTGGGAGCGTATTCGCAACCTGCTTAAAGA
AACGGCACCGGACATGGCGGTGCTGACCTGTATGTACCGTACCCTGCAGCTGGGCTTTGTCGGGCAGTAC
CGGGCTGAAGACGATGAACGACGTGAAGATGTGGTACGGGCACTGGGTGAACGTGTGCCTGCCTTTACGC
TTTCGCAGGATGCGCCGATTGTCGCAAGGGCTTCCCGTCTGCGCAGCGGTCGTCTGTACTGGGTTTCCTG
GATTATCGGGGCGGCCGTACTGGTGGTGCTGTGGTTCTTCCTTTCTTCCTCCCTCACCGAACTGGTGAGT
CAGACGGTCAGTCCGGGGTAA