SecReT6
Protein ID: 161504618
SecReT6 ID238
T6SS typei2
Gene symbol-
Locus tagSARI_02732
StrainSalmonella enterica subsp. arizonae serovar 62:z4,z23:- str. RSK2980
Repliconchromosome [GenBank: NC_010067] [Browse all T6SS(s) in this replicon]
Location [Strand]2646121..2647458 [-]
Producthypothetical protein
NoteTssK
UniProt IDA9MPE5
KEGG IDses:SARI_02732
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.30E-129, Aligned region: 18..442
Protein Sequence: 445 a.a.     [Download]
>gi|161504618|ref|YP_001571730.1| hypothetical protein SARI_02732 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
MKIYRPLWEDGAALAPQQFQQQARWNEHVASMVARMGVSYPWGVVAAEFDDAALALSRLNATRLVVRFQD
GTIVDTDLADNLPPVCDLSTASGSESVDVVVALPLLSASGGNLDSGQDSERPRRWKAERVMVQELAGHES
GELAILRNAITLRLSTQENTAYLTCPVTRLVRNAQGQWSRDPAFIPPMLSVSASPLLTTELGDLLVRLQA
RRRRLMAMRRESNERMADFAVADVSLFWLLNALNSTEPVLTELLQTPERHPELLYRELTRLAGSLLTFSL
EHDAGDIPAYQHDAPERVFPPLLALLDKLLEASLPSRVVSIHLEHQDQIWKGALYDARLREGADFYLSVR
SSMPNHELQTRFPQLCKAGSFEDVSDVVNVALSGIEIKPLTHVPAAIPLRLENQYFSLDLSSDVARTMLE
MGSCTFYTPRSLGEVKLELFAVLRT
 
Nucleotide Sequence: 1338 bp     [Download]
>ref|NC_010067.1|:c2647458-2646121 hypothetical protein SARI_02732 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
ATGAAAATTTACCGCCCACTTTGGGAGGACGGGGCCGCTCTGGCCCCGCAACAGTTCCAACAGCAGGCCC
GCTGGAATGAGCACGTTGCCAGCATGGTCGCCCGGATGGGGGTTTCTTATCCCTGGGGTGTGGTGGCCGC
AGAGTTTGATGATGCCGCGCTTGCGCTGTCTCGCCTGAATGCCACCCGTCTGGTGGTACGTTTCCAGGAT
GGCACGATTGTTGATACAGATCTGGCAGATAATCTTCCGCCAGTCTGTGATTTATCCACGGCAAGCGGCT
CTGAGTCTGTTGACGTGGTTGTCGCACTGCCGCTGCTGAGCGCCAGCGGCGGCAATCTTGATAGCGGGCA
GGACAGTGAACGCCCGCGTCGCTGGAAAGCGGAACGTGTGATGGTCCAGGAGCTGGCCGGGCATGAAAGC
GGTGAACTGGCCATTCTGCGTAATGCCATCACACTGCGTTTGTCCACTCAGGAAAATACCGCATACCTGA
CCTGTCCGGTCACCCGTCTGGTGCGTAATGCGCAGGGGCAGTGGAGCCGGGACCCGGCTTTCATTCCGCC
GATGCTTTCCGTTTCTGCGAGCCCGTTGCTGACCACTGAACTGGGTGATCTGCTGGTTCGTCTGCAGGCC
CGTCGCCGTCGCCTGATGGCCATGCGCCGGGAAAGCAATGAGCGGATGGCCGACTTTGCGGTCGCGGATG
TCTCCCTGTTCTGGCTGCTCAATGCCCTGAACAGCACCGAGCCGGTGCTGACGGAACTGCTTCAGACGCC
TGAGCGTCACCCGGAACTGCTGTACCGCGAACTGACCCGTCTGGCCGGCAGCCTGCTGACCTTCTCACTG
GAGCACGATGCCGGGGACATTCCTGCTTATCAGCATGATGCACCGGAGCGGGTATTCCCGCCGTTGCTGG
CACTGCTCGATAAGCTGCTGGAAGCGAGCCTGCCGTCACGGGTGGTGAGTATCCACCTGGAGCATCAGGA
TCAGATCTGGAAAGGTGCCCTGTACGATGCGCGCCTGCGCGAAGGTGCTGATTTTTATCTCTCGGTGCGT
TCCTCCATGCCGAATCACGAGCTCCAGACCCGGTTCCCGCAGCTGTGTAAGGCGGGCAGTTTTGAGGATG
TCTCGGATGTGGTGAACGTGGCGCTGAGCGGAATAGAGATCAAACCTCTGACGCATGTTCCCGCCGCGAT
CCCTTTGCGCTTGGAGAACCAGTACTTCTCGCTGGACCTGAGTTCTGACGTGGCCCGGACCATGCTTGAA
ATGGGCAGTTGTACCTTCTATACCCCGCGTTCTCTGGGAGAGGTGAAACTTGAACTCTTTGCGGTGCTGC
GCACATGA