SecReT6
Protein ID: 161504619
SecReT6 ID238
T6SS typei2
Gene symbol-
Locus tagSARI_02733
StrainSalmonella enterica subsp. arizonae serovar 62:z4,z23:- str. RSK2980
Repliconchromosome [GenBank: NC_010067] [Browse all T6SS(s) in this replicon]
Location [Strand]2647477..2649024 [-]
Producthypothetical protein
NoteTssC
UniProt IDA9MPE6
KEGG IDses:SARI_02733
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 6.80E-175, Aligned region: 89..511
Protein Sequence: 515 a.a.     [Download]
>gi|161504619|ref|YP_001571731.1| hypothetical protein SARI_02733 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
MLMSVKNENAAGGESVVLERPAAGGVYASLFEKINLNPVSELSALDIWQDAQAMSDATADERLTAGMQVF
LECLTKAGSKVEKLDKNLIDHHIAELDYQISRQLDAVMHSEEFQAVESLWRGVKSLVDKTDFRQNVKVEL
LDMSKEDLRQDFEDSPEIIQSGLYKHTYIDEYDTPGGEPIAALISAYEFDASAQDVALLRNISKVAAAAH
MPFIGSAGPAFFLKNSMEEVAAIKDIGNYFDRAEYIKWKSFRETDDARYIGLVMPRVLGRLPYGPDTVPV
RSFNYVEEVKGPDHDKYLWTNASFAFASNMVRSFINNGWCVQIRGPQAGGAVQDLPIHLYDLGTGNQVKI
PSEVMIPETREFEFANLGFIPLSYYKNRDFAAFFSANSTQKPAIYDTADATANSRINARLPYIFLLSRIA
HYLKLIQRENIGTTKDRRLLELELNTWVKSLVTEMTDPGDELQASHPLRDAKVVVEDIEDNPGFFRVKLY
AVPHFQVEGMDVNLSLVSQMPKAKS
 
Nucleotide Sequence: 1548 bp     [Download]
>ref|NC_010067.1|:c2649024-2647477 hypothetical protein SARI_02733 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
ATGCTGATGTCTGTAAAAAATGAGAATGCGGCCGGTGGCGAGAGTGTGGTGCTGGAACGTCCTGCTGCAG
GTGGCGTTTATGCGTCCCTGTTTGAAAAAATCAACCTGAACCCGGTCTCTGAGCTGAGTGCGCTGGATAT
CTGGCAGGACGCGCAGGCGATGTCGGATGCGACTGCGGATGAACGTTTAACGGCCGGCATGCAGGTGTTC
CTGGAGTGCCTGACGAAAGCGGGCTCAAAGGTTGAAAAACTCGACAAAAACCTGATTGACCACCATATTG
CTGAGCTGGACTACCAGATTAGCCGTCAGCTGGATGCGGTCATGCACAGCGAAGAATTCCAGGCGGTAGA
GAGTCTGTGGCGCGGCGTTAAATCGCTGGTCGACAAAACCGATTTTCGCCAGAACGTGAAGGTTGAACTG
CTGGATATGTCCAAAGAAGACCTGCGTCAGGACTTCGAAGACAGCCCGGAAATCATCCAGAGTGGACTGT
ATAAACATACCTATATTGATGAATATGACACCCCGGGCGGTGAGCCGATTGCCGCGCTGATTTCTGCTTA
CGAGTTTGATGCCTCTGCGCAGGATGTTGCCCTGCTGCGTAATATATCAAAAGTGGCCGCTGCTGCCCAT
ATGCCGTTTATCGGTTCTGCGGGTCCGGCGTTCTTTTTGAAAAATTCGATGGAAGAAGTCGCCGCCATTA
AAGATATCGGTAACTACTTTGACCGCGCTGAATATATCAAGTGGAAATCCTTCCGCGAGACGGACGATGC
CCGCTATATCGGTCTGGTGATGCCGCGTGTGCTGGGCCGCCTGCCGTATGGCCCGGACACCGTGCCCGTA
CGCAGCTTCAACTACGTCGAAGAAGTGAAGGGCCCGGATCACGACAAATACCTGTGGACTAACGCCTCGT
TTGCCTTTGCATCCAACATGGTACGCAGTTTCATCAACAACGGCTGGTGTGTGCAGATCCGTGGCCCGCA
GGCCGGTGGTGCCGTTCAGGATTTGCCTATCCATCTGTACGATCTGGGCACCGGCAATCAGGTCAAGATC
CCGTCAGAAGTGATGATCCCGGAAACCCGTGAATTTGAATTTGCGAATCTCGGCTTCATTCCGCTGTCCT
ACTACAAGAACCGCGATTTTGCCGCATTCTTCAGTGCAAACTCCACGCAGAAGCCAGCTATCTACGATAC
CGCTGATGCCACAGCAAACAGCCGCATCAATGCCCGTTTGCCGTACATTTTCCTGCTGTCGCGTATTGCG
CACTACCTGAAGCTGATTCAGCGTGAAAACATTGGTACCACCAAGGACCGTCGTTTGCTGGAGCTGGAAC
TCAATACCTGGGTGAAAAGTCTGGTCACCGAAATGACCGATCCGGGCGATGAACTGCAGGCGTCACACCC
GCTGCGCGATGCCAAAGTGGTGGTGGAAGACATCGAAGACAACCCGGGCTTCTTCCGCGTGAAGCTGTAT
GCCGTGCCGCACTTCCAGGTGGAAGGGATGGACGTCAACCTGTCACTGGTTTCCCAGATGCCGAAAGCCA
AATCCTAA