SecReT6
Protein ID: 161504620
SecReT6 ID238
T6SS typei2
Gene symbol-
Locus tagSARI_02734
StrainSalmonella enterica subsp. arizonae serovar 62:z4,z23:- str. RSK2980
Repliconchromosome [GenBank: NC_010067] [Browse all T6SS(s) in this replicon]
Location [Strand]2649059..2649595 [-]
Producthypothetical protein
NoteTssB
UniProt IDA9MPE7
KEGG IDses:SARI_02734
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.10E-52, Aligned region: 19..171
Protein Sequence: 178 a.a.     [Download]
>gi|161504620|ref|YP_001571732.1| hypothetical protein SARI_02734 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
MKTIHSDKPRDDEMADSFQNEVPKARINLKLDLHTGGASKKTELPLKLLVAGDFSNGQESAPLSERKKVN
LNKNNFDSVLSEYSPNVNLTVKNTLADDGSEDNISLTFRSMKDFSPEQVSRQIPQLKAMLSMRNLLRDLK
ANLLDNQAFRKELEKILLDPALSAELRTELSALAPKQP
 
Nucleotide Sequence: 537 bp     [Download]
>ref|NC_010067.1|:c2649595-2649059 hypothetical protein SARI_02734 [Salmonella enterica subsp. arizonae serovar 62:z4,z23:-- str. RSK2980]
GTGAAAACGATACACAGCGATAAACCGAGGGATGATGAGATGGCCGACAGTTTCCAGAATGAAGTGCCAA
AGGCACGTATTAATCTAAAACTTGACCTGCATACCGGGGGAGCCAGCAAGAAAACGGAACTCCCTTTGAA
ATTACTGGTGGCGGGCGACTTCAGTAACGGTCAGGAGTCTGCACCACTGTCTGAGCGAAAAAAAGTTAAT
TTGAATAAAAATAACTTCGACTCAGTGCTTTCCGAATATTCCCCAAACGTCAATCTTACCGTTAAAAACA
CGCTGGCTGATGACGGTAGCGAAGACAATATCAGTCTGACCTTCCGGAGCATGAAGGACTTCTCGCCGGA
ACAGGTTTCCCGGCAAATCCCTCAGTTGAAGGCCATGCTTTCCATGCGCAATTTACTCCGTGACCTCAAG
GCCAACCTTTTAGATAACCAGGCGTTCCGAAAGGAACTGGAAAAAATTCTGCTCGACCCGGCGTTAAGTG
CAGAACTCCGCACAGAGCTGTCTGCTCTGGCCCCGAAACAGCCATAA