SecReT6
Protein ID: 161520449
SecReT6 ID241
T6SS typei3
Gene symbol-
Locus tagBmul_3901
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome II [GenBank: NC_010086] [Browse all T6SS(s) in this replicon]
Location [Strand]865751..866869 [-]
ProductImpA domain-containing protein
NoteTssA
UniProt IDA9APY1
KEGG IDbmj:BMULJ_04600, bmu:Bmul_3901
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.80E-22, Aligned region: 71..130
Protein Sequence: 372 a.a.     [Download]
>gi|161520449|ref|YP_001583876.1| ImpA domain-containing protein [Burkholderia multivorans ATCC 17616]
MSRKSSTTPNRAGRAAVADTPHENWLAPLSESAPCGPDLEYDHDFVVLFAGTTPRQDVQYGGFVGSPEPL
NWSEIERDCRRLMGRTKDIRVAVLYARCRTRLAGVEGLAEGTGLLAGWLQAFPEQVHPRADIDDDRHAAL
EMRMNALQALADPEGLLADVREIVLTRSTAARLQVRDVERAFAHPRPIDALAPDSVALQLQNLREQQPST
MKAFDDAIANLCAIDAWCATHLETSLPDFSPLVRLLRLFQVGDAPGGTRSDTLPSAEREECEAPVPPVFG
DAPSAPPRVDDAQTAAPASTSVAAPASLAPTDRQAALALICAARRWFETHEPSSPIPVLLARAEQFVGKR
YVDVVKAIPAELLAQWEAADGS
 
Nucleotide Sequence: 1119 bp     [Download]
>gi|161519706|ref|NC_010086.1|:c866869-865751 Burkholderia multivorans ATCC 17616 chromosome 2, complete sequence
ATGAGCAGGAAATCGTCCACCACGCCAAACAGGGCCGGCCGCGCAGCCGTCGCCGATACGCCGCACGAGA
ACTGGCTCGCGCCGTTGAGCGAGTCGGCGCCGTGCGGCCCCGATCTCGAATACGACCACGATTTCGTCGT
GCTGTTTGCCGGCACCACGCCGAGACAGGACGTGCAATACGGTGGCTTCGTCGGTTCGCCCGAGCCGCTG
AACTGGAGCGAGATCGAGCGAGACTGCCGGCGGCTGATGGGGCGGACGAAGGACATACGCGTCGCCGTGC
TGTATGCGCGCTGTCGCACGCGCCTGGCCGGCGTGGAAGGTCTTGCGGAGGGAACGGGGCTATTGGCGGG
CTGGTTGCAGGCATTTCCGGAGCAGGTGCATCCACGGGCCGATATCGACGACGATCGCCATGCCGCGTTG
GAAATGCGGATGAACGCGCTGCAAGCGCTGGCGGATCCGGAAGGCCTGCTGGCCGACGTGCGGGAAATCG
TCCTGACGCGATCGACGGCCGCCCGGCTGCAGGTACGCGACGTCGAGCGTGCGTTCGCGCATCCGCGACC
GATCGATGCGCTCGCACCCGACTCGGTCGCGCTGCAGTTGCAGAACCTGCGCGAACAGCAACCGTCGACG
ATGAAGGCCTTCGACGACGCGATCGCGAATCTCTGTGCCATCGATGCGTGGTGCGCGACGCATCTCGAAA
CGTCGCTGCCGGATTTTTCCCCGCTGGTCCGCCTGCTTCGGCTCTTTCAGGTCGGCGACGCGCCGGGCGG
CACGCGGTCCGACACCTTGCCTTCGGCCGAGCGCGAGGAATGCGAGGCGCCGGTGCCGCCGGTGTTCGGC
GACGCGCCTTCTGCCCCGCCCCGTGTGGACGACGCGCAAACGGCTGCGCCCGCTTCGACGTCCGTCGCCG
CGCCCGCTTCGCTCGCGCCGACAGACCGGCAGGCAGCGCTGGCGTTGATCTGCGCGGCACGCCGCTGGTT
CGAGACGCACGAACCAAGCAGCCCCATTCCGGTGCTGCTCGCACGCGCCGAACAATTCGTCGGAAAGCGC
TATGTCGATGTCGTCAAGGCGATTCCGGCGGAACTGCTCGCTCAATGGGAAGCGGCAGACGGATCATGA