SecReT6
Protein ID: 161520450
SecReT6 ID241
T6SS typei3
Gene symbol-
Locus tagBmul_3902
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome II [GenBank: NC_010086] [Browse all T6SS(s) in this replicon]
Location [Strand]866866..867942 [-]
Producttype VI secretion protein
NoteTssG
UniProt IDB3D8E3, A9APY2
KEGG IDbmu:Bmul_3902, bmj:BMULJ_04599
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 5.20E-104, Aligned region: 26..326
Protein Sequence: 358 a.a.     [Download]
>gi|161520450|ref|YP_001583877.1| type VI secretion protein [Burkholderia multivorans ATCC 17616]
MMQRAALPEPLRDHALSAELLDALLAEPWRFGFLSLMRRIGTNAALDPIGTARRPQAEPFRLGQQPSLAF
APREIASAHETAGQLKVRLFGLGMLGPNGPLPIHVTEIARDRESSRRDTTTVDFFDIFHHRFFTLFYRAW
ASAQAAAGLDRKHREQFSFYVASLIGHELGEIERRPLPSHARLAASAHLIRESRNPDGLRATLEHYFGVP
VAVVENVFHWIEIDLADCGRMGYPGAAATMGRGAVLGRVAPDRQHRFRIVIGPVDLDAYLRFTPQGEDLP
RLVEWVRAFVGRELEWELELRIQPESAPPAVMGGRQRLGWSGWLGRPAPDKPITGMRFQPERHPRHFNRR
HTDSGHRA
 
Nucleotide Sequence: 1077 bp     [Download]
>gi|161519706|ref|NC_010086.1|:c867942-866866 Burkholderia multivorans ATCC 17616 chromosome 2, complete sequence
GTGATGCAGCGCGCCGCGCTTCCCGAACCGCTGCGCGATCACGCGCTGTCGGCGGAACTGCTCGACGCCC
TGCTGGCCGAGCCCTGGCGTTTCGGCTTCCTGTCGTTGATGCGGCGGATCGGCACGAACGCCGCACTCGA
TCCGATCGGCACCGCGCGCCGCCCGCAGGCCGAACCGTTCCGACTGGGCCAGCAGCCGAGCCTGGCGTTC
GCACCGCGGGAAATCGCGAGCGCGCACGAAACGGCCGGGCAGCTCAAGGTGCGGCTGTTCGGCCTCGGCA
TGCTCGGGCCCAACGGCCCGCTGCCCATCCACGTGACGGAAATCGCGAGGGATCGGGAAAGCAGCCGCCG
CGATACGACCACGGTCGACTTCTTCGACATCTTCCATCACCGGTTCTTCACGCTGTTCTATCGTGCGTGG
GCCTCCGCACAGGCGGCTGCGGGCCTCGACCGCAAACACCGCGAACAGTTCTCGTTCTATGTCGCCAGCC
TGATCGGGCACGAGCTCGGCGAGATCGAACGGCGCCCCCTTCCGTCGCATGCGCGCCTGGCCGCCTCGGC
CCATCTCATTCGCGAATCGCGCAATCCGGACGGGCTGCGCGCGACGCTCGAGCATTATTTCGGCGTCCCG
GTGGCGGTGGTGGAAAACGTCTTTCACTGGATCGAAATCGATCTGGCCGACTGCGGGCGCATGGGCTATC
CGGGCGCCGCCGCGACGATGGGCCGCGGCGCCGTGCTCGGACGCGTCGCCCCCGACCGCCAGCACCGATT
CCGCATCGTGATCGGCCCCGTCGATCTCGACGCATACCTGCGCTTCACGCCGCAGGGCGAAGACCTGCCA
CGGCTCGTCGAGTGGGTGCGCGCCTTCGTCGGTCGCGAGCTCGAATGGGAACTCGAGCTGCGCATCCAAC
CCGAGAGCGCGCCGCCGGCCGTGATGGGCGGCCGCCAGCGCTTGGGCTGGTCCGGCTGGCTGGGCCGGCC
CGCACCCGACAAGCCGATCACCGGCATGCGCTTCCAGCCCGAACGCCATCCACGCCACTTCAATCGCCGC
CATACGGATTCCGGACATCGAGCATGA