SecReT6
Protein ID: 161520451
SecReT6 ID241
T6SS typei3
Gene symbol-
Locus tagBmul_3903
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome II [GenBank: NC_010086] [Browse all T6SS(s) in this replicon]
Location [Strand]867939..869828 [-]
Producttype VI secretion protein
NoteTssF
UniProt IDA9APY3
KEGG IDbmj:BMULJ_04598, bmu:Bmul_3903
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.90E-219, Aligned region: 5..629
Protein Sequence: 629 a.a.     [Download]
>gi|161520451|ref|YP_001583878.1| type VI secretion protein [Burkholderia multivorans ATCC 17616]
MDPRLLDYYNQELIYMRELAAEFAHAHPKIARRLGMQAGEVADPYVERLIESFSFMAARMQLKLDAEFPR
FTERLLEVIYPNYVAPTPSISIARLYPGQTEGSLVDGYRLPRGTTFTAQVPDGERTACRFTSGQDVTLWP
LAITDARLTGIPPDIPALARYSAPDTPVRGALRIRLATTGNVRIADLKGLDRLPVYLAGDEQVASHLFEL
LHAGAIASVIGAPGEFGRPGRSPAAVTERAVEHEGLGTDQSLLPLNWAKFHGHNLLHEYFACPARFWFFA
LNGLAEGFSRIDGREVEIVVLLDRAPGPLANLVDASRFALFCTPVVNLFRKHTDRVEISPRDTEFHLVPA
RLTPLDYEVFSVSAVYGQVAATSSELEFRPLYQTLNNDEGNHGRYFSVRRERRLLSDSARRYGTRTPYVG
TEVFLSLVDQAEAPYGENIRFLSVDALLTNRDLATLVPRDGVRDLETAQSAPVDSIGLIRPPSAPLPPYA
ERETAWRLIRQLNFDHLPLEALDHREGGQGLRDLLRLYLVDGDSGQSRQVESLVGAKTRPVTRKLPGTGP
MTFGRGIECTLTVDETGFSGVSPYLFGTILEHWLARHVSINSFTQTELHSMQRGRIARWPARTGTRGVL
 
Nucleotide Sequence: 1890 bp     [Download]
>gi|161519706|ref|NC_010086.1|:c869828-867939 Burkholderia multivorans ATCC 17616 chromosome 2, complete sequence
ATGGACCCGCGACTGCTCGACTACTACAACCAGGAACTCATCTACATGCGCGAGCTCGCCGCCGAGTTCG
CACATGCGCATCCGAAGATCGCGCGTCGGCTCGGCATGCAGGCCGGCGAGGTGGCGGACCCGTATGTCGA
GCGCCTGATCGAATCGTTCAGCTTCATGGCCGCGCGCATGCAGCTCAAGCTCGATGCAGAATTTCCGCGC
TTCACGGAACGGCTGCTCGAGGTCATCTATCCGAACTACGTCGCGCCGACGCCGTCGATCTCGATCGCCC
GGCTGTACCCCGGACAGACCGAAGGCAGCCTCGTCGACGGCTATCGCCTCCCGCGCGGCACCACGTTCAC
GGCGCAGGTTCCCGACGGCGAGCGCACGGCCTGCCGGTTCACGAGCGGACAGGACGTCACGCTGTGGCCG
CTCGCGATCACCGACGCGCGGCTGACCGGCATTCCACCGGATATCCCCGCGCTCGCGCGCTATAGCGCGC
CCGATACACCCGTGCGCGGCGCGCTGCGAATCAGGCTCGCGACCACCGGCAACGTGCGGATCGCCGACCT
GAAAGGACTCGACCGGCTCCCGGTCTATCTGGCAGGCGACGAACAGGTCGCGTCGCATCTGTTCGAATTG
CTGCATGCGGGCGCGATCGCCTCGGTCATCGGCGCACCGGGCGAATTCGGCAGGCCCGGCCGCTCACCGG
CGGCCGTCACCGAACGCGCGGTCGAACACGAGGGGCTGGGCACCGATCAAAGCCTGCTGCCGCTGAACTG
GGCCAAGTTCCACGGGCACAATCTGCTGCACGAGTACTTTGCCTGCCCCGCGCGCTTCTGGTTCTTCGCG
TTGAACGGCCTCGCCGAAGGGTTCTCGCGCATCGACGGCCGGGAAGTCGAGATCGTCGTGCTGCTCGACC
GTGCGCCGGGGCCGCTCGCCAATCTCGTCGATGCGTCGCGCTTCGCGCTCTTCTGTACGCCCGTCGTCAA
CCTGTTCCGCAAGCACACCGACCGCGTCGAGATTTCGCCGCGCGATACCGAATTCCATCTGGTTCCGGCT
CGGCTCACGCCGCTCGACTACGAGGTGTTCTCGGTCAGCGCCGTCTACGGTCAGGTTGCCGCCACGTCGT
CCGAGCTCGAATTCCGGCCGCTCTATCAGACGCTGAACAACGACGAAGGCAATCACGGCCGCTATTTTTC
GGTGCGGCGCGAACGGCGGCTGCTGTCCGATTCGGCGCGCCGCTACGGCACACGCACGCCGTACGTGGGA
ACGGAAGTGTTTCTCTCGCTCGTCGACCAGGCCGAGGCGCCGTATGGCGAAAACATCCGCTTCCTGTCGG
TCGACGCGCTATTGACGAACCGCGATCTCGCCACGCTCGTGCCGCGCGACGGCGTGCGCGACCTCGAGAC
CGCGCAATCCGCGCCGGTCGACAGCATCGGTCTGATCCGGCCGCCGAGCGCACCGTTGCCGCCGTATGCC
GAGCGGGAAACGGCATGGCGTCTGATCCGCCAGCTGAACTTCGACCATCTGCCGCTCGAGGCGCTCGATC
ACCGCGAAGGCGGGCAAGGCCTGCGCGACCTGCTGCGCCTGTATCTCGTGGATGGCGACTCCGGGCAAAG
CCGGCAGGTCGAAAGCCTCGTCGGCGCGAAAACGCGCCCCGTGACGCGCAAGCTGCCGGGAACCGGCCCG
ATGACCTTCGGCCGCGGCATCGAATGCACGCTGACGGTCGACGAGACAGGCTTCTCGGGCGTGAGCCCCT
ATCTTTTCGGCACGATCCTCGAACACTGGCTCGCGCGCCACGTGTCGATCAACAGCTTCACGCAGACGGA
GCTGCATTCGATGCAACGCGGCCGGATCGCGCGCTGGCCGGCGCGCACCGGCACGCGCGGAGTGCTGTGA