SecReT6
Protein ID: 161520452
SecReT6 ID241
T6SS typei3
Gene symbol-
Locus tagBmul_3904
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome II [GenBank: NC_010086] [Browse all T6SS(s) in this replicon]
Location [Strand]869864..870430 [-]
Producttype VI secretion system lysozyme-like protein
NoteTssE
UniProt IDA9APY4
KEGG IDbmj:BMULJ_04597, bmu:Bmul_3904
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.80E-18, Aligned region: 52..166
Protein Sequence: 188 a.a.     [Download]
>gi|161520452|ref|YP_001583879.1| type VI secretion system lysozyme-like protein [Burkholderia multivorans ATCC 17616]
MTERRKRQPGTDAPTARTPRRASSHLMPTLLDRLRDDAPYRQTEAPEAYTATRKQMRDIVQRDLAYLLNT
TSIEDRIDRARYPQAAASTVNFGVPPLAGTFIASRRWSDVETMIRRAIGDFEPRLIPESLVVSPRTDTDV
DSAGEHRNVLAFEVRGLIHMDPYPLEFMVQSSLDLETSEIRITGMRAG
 
Nucleotide Sequence: 567 bp     [Download]
>gi|161519706|ref|NC_010086.1|:c870430-869864 Burkholderia multivorans ATCC 17616 chromosome 2, complete sequence
ATGACCGAACGCCGAAAACGCCAGCCCGGTACCGATGCCCCGACCGCACGTACGCCGCGGCGCGCCAGCT
CGCATCTGATGCCGACGCTGCTCGACCGCCTGCGCGACGATGCCCCGTATCGACAGACCGAAGCGCCCGA
GGCATACACGGCGACGCGCAAGCAGATGCGCGACATCGTTCAGCGCGATCTCGCCTATCTGCTCAACACG
ACCAGTATCGAAGACCGGATCGATCGCGCCCGCTATCCGCAAGCGGCCGCGTCGACCGTCAATTTCGGCG
TGCCGCCGCTCGCCGGCACCTTTATCGCATCGCGCCGGTGGAGCGACGTCGAAACCATGATCCGCCGCGC
GATCGGCGATTTCGAGCCCCGGCTGATTCCGGAGTCGCTCGTGGTATCGCCGCGCACCGACACCGATGTC
GATAGCGCCGGCGAACATCGCAACGTGCTCGCCTTCGAAGTGCGCGGCCTGATCCACATGGATCCGTATC
CGCTCGAATTCATGGTGCAAAGCTCGCTGGATCTCGAAACGAGCGAAATCCGGATCACCGGCATGCGCGC
CGGCTGA