SecReT6
Protein ID: 161520454
SecReT6 ID241
T6SS typei3
Gene symbol-
Locus tagBmul_3906
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome II [GenBank: NC_010086] [Browse all T6SS(s) in this replicon]
Location [Strand]871723..874404 [+]
Producttype VI secretion ATPase
NoteTssH
UniProt IDA9APY6
KEGG IDbmj:BMULJ_04595, bmu:Bmul_3906
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 4.00E-38, Aligned region: 230..310
AAA_2 [PF07724], Evalue: 4.00E-38, Aligned region: 611..777
AAA [PF00004], Evalue: 8.40E-21, Aligned region: 232..364
AAA [PF00004], Evalue: 8.40E-21, Aligned region: 616..700
AAA_5 [PF07728], Evalue: 1.80E-14, Aligned region: 232..310
AAA_5 [PF07728], Evalue: 1.80E-14, Aligned region: 615..720
ClpB_D2-small [PF10431], Evalue: 3.60E-14, Aligned region: 783..853
AAA_16 [PF13191], Evalue: 1.00E-09, Aligned region: 33..77
AAA_16 [PF13191], Evalue: 1.00E-09, Aligned region: 209..254
AAA_16 [PF13191], Evalue: 1.00E-09, Aligned region: 273..310
AAA_16 [PF13191], Evalue: 1.00E-09, Aligned region: 600..815
Sigma54_activat [PF00158], Evalue: 2.30E-08, Aligned region: 227..312
Sigma54_activat [PF00158], Evalue: 2.30E-08, Aligned region: 615..715
AAA_19 [PF13245], Evalue: 2.30E-07, Aligned region: 230..255
AAA_19 [PF13245], Evalue: 2.30E-07, Aligned region: 366..387
AAA_19 [PF13245], Evalue: 2.30E-07, Aligned region: 613..637
AAA_22 [PF13401], Evalue: 6.20E-07, Aligned region: 232..313
AAA_22 [PF13401], Evalue: 6.20E-07, Aligned region: 418..478
AAA_22 [PF13401], Evalue: 6.20E-07, Aligned region: 497..541
AAA_22 [PF13401], Evalue: 6.20E-07, Aligned region: 614..638
AAA_22 [PF13401], Evalue: 6.20E-07, Aligned region: 676..702
AAA_17 [PF13207], Evalue: 5.10E-06, Aligned region: 232..274
AAA_17 [PF13207], Evalue: 5.10E-06, Aligned region: 615..653
IstB_IS21 [PF01695], Evalue: 6.40E-06, Aligned region: 226..254
IstB_IS21 [PF01695], Evalue: 6.40E-06, Aligned region: 615..635
IstB_IS21 [PF01695], Evalue: 6.40E-06, Aligned region: 688..749
NACHT [PF05729], Evalue: 2.10E-05, Aligned region: 232..259
NACHT [PF05729], Evalue: 2.10E-05, Aligned region: 615..642
AAA_29 [PF13555], Evalue: 2.10E-05, Aligned region: 224..254
AAA_29 [PF13555], Evalue: 2.10E-05, Aligned region: 613..640
AAA_14 [PF13173], Evalue: 5.00E-05, Aligned region: 232..313
AAA_14 [PF13173], Evalue: 5.00E-05, Aligned region: 614..697
Clp_N [PF02861], Evalue: 0.00012, Aligned region: 26..74
AAA_18 [PF13238], Evalue: 0.00013, Aligned region: 232..271
AAA_18 [PF13238], Evalue: 0.00013, Aligned region: 616..647
AAA_25 [PF13481], Evalue: 0.00019, Aligned region: 232..259
AAA_25 [PF13481], Evalue: 0.00019, Aligned region: 473..525
AAA_25 [PF13481], Evalue: 0.00019, Aligned region: 613..642
Zeta_toxin [PF06414], Evalue: 0.00025, Aligned region: 232..256
Zeta_toxin [PF06414], Evalue: 0.00025, Aligned region: 471..510
Zeta_toxin [PF06414], Evalue: 0.00025, Aligned region: 614..655
T2SE [PF00437], Evalue: 0.00083, Aligned region: 223..253
T2SE [PF00437], Evalue: 0.00083, Aligned region: 599..685
RNA_helicase [PF00910], Evalue: 0.003, Aligned region: 233..253
RNA_helicase [PF00910], Evalue: 0.003, Aligned region: 616..637
SRP54 [PF00448], Evalue: 0.0038, Aligned region: 232..254
SRP54 [PF00448], Evalue: 0.0038, Aligned region: 422..473
SRP54 [PF00448], Evalue: 0.0038, Aligned region: 614..642
NTPase_1 [PF03266], Evalue: 0.0042, Aligned region: 232..256
NTPase_1 [PF03266], Evalue: 0.0042, Aligned region: 615..637
Hpr_kinase_C [PF07475], Evalue: 0.0043, Aligned region: 232..243
Hpr_kinase_C [PF07475], Evalue: 0.0043, Aligned region: 613..633
Hpr_kinase_C [PF07475], Evalue: 0.0043, Aligned region: 810..824
Arch_ATPase [PF01637], Evalue: 0.0051, Aligned region: 211..246
Arch_ATPase [PF01637], Evalue: 0.0051, Aligned region: 285..315
Arch_ATPase [PF01637], Evalue: 0.0051, Aligned region: 614..654
AAA_23 [PF13476], Evalue: 0.0088, Aligned region: 232..252
AAA_23 [PF13476], Evalue: 0.0088, Aligned region: 613..641
Protein Sequence: 893 a.a.     [Download]
>gi|161520454|ref|YP_001583881.1| type VI secretion ATPase [Burkholderia multivorans ATCC 17616]
MNISRQTLFGKLGVELYRGIESATRFCKLRGNPFVELVHWLHQLLQQPDGDLQRIVRHADIDRDALERDL
ARALAALPAGASSISDFSWHIETAIERGWVLATLGHGDCRVRGAWLIAALVSTPELRRVLLAISAEFGKI
PVASLGDVLPAWIDGSPEASDEPYDRSKLAPALPGEASGAVSDAPKGNALERYCLDLTARARAGEIDPVI
GRELEIRTMVDVLLRRRQNNPLITGEAGVGKTAMVEGLAHAIAAGNVPPNLADVRLLSLDVGALLAGASM
KGEFEARLKGVLEAAARSAAPIILFVDEIHTLIGAGGQAGTGDAANLLKPALARGTIRTIGATTWAEYKR
HIEKDPALTRRFQVLQVAEPSEAAAADMVRGLASTFSSHHGVVVRDEAIRAAVTLSHRYIPSRQLPDKAI
SLLDTACARVALSQHATPRELDDVRQRLAAARTEETLLVQEARIGLEADKALHRVRTRIDALATEEAALA
DRWRAQAQAAQALLSAREAAIADERDSPVSLDSLRELERTLVALQGDAPLVFPEVDAAIVAEIVSDWTGI
PVGRMVTDEIVAVRRLPETLAVRVIGQSDALNLIGERVQTARSGLTDPNKPLGVFLLAGPSGVGKTETAL
ALAEALYGGEQNLITINMSEYQEAHTVSGLKGAPPGYVGYGEGGVLTEAVRRRPYAVVLLDEIEKAHRDV
HEMFFQVFDKGYMEDGDGRHIDFRHTTILLTSNVGAELGASLCADPALAPDLDGLRDALAPELLKVFPAA
FMGRVTVVPYRPLAADALASIVRLHLDRVAKRMAHTHDIALVCDDAVVHYIVGRCLVQETGARVLIGFIE
QHVLPRLSALWLDAFASRVPLARIAIGVTDSSASPAQALTFEATPSHPLEPRR
 
Nucleotide Sequence: 2682 bp     [Download]
>gi|161519706|ref|NC_010086.1|:871723-874404 Burkholderia multivorans ATCC 17616 chromosome 2, complete sequence
ATGAACATTTCACGCCAGACCTTGTTCGGCAAGCTCGGGGTCGAGCTCTACCGCGGAATCGAATCGGCGA
CGCGTTTCTGCAAGCTGCGCGGGAACCCGTTCGTCGAACTCGTCCACTGGCTGCATCAACTGCTCCAGCA
GCCGGACGGCGACCTGCAGCGGATCGTGCGCCATGCGGATATCGACCGCGATGCGCTCGAGCGCGATCTG
GCGCGGGCGTTGGCTGCGCTGCCGGCCGGCGCGAGTTCGATCAGCGATTTCTCCTGGCACATCGAAACGG
CCATCGAGCGCGGCTGGGTGCTGGCGACCCTCGGCCATGGCGATTGTCGCGTGCGCGGCGCATGGCTGAT
CGCAGCGCTGGTCTCGACACCGGAACTGCGGCGCGTGCTCCTCGCCATTTCCGCCGAGTTCGGCAAGATC
CCGGTGGCGAGTCTTGGCGACGTGCTTCCCGCGTGGATCGACGGGTCGCCGGAGGCGTCGGACGAGCCGT
ACGATCGCAGCAAGCTCGCGCCGGCGCTGCCGGGCGAGGCTTCCGGTGCCGTGTCGGACGCGCCGAAGGG
CAACGCGCTCGAGCGGTATTGCCTCGATCTCACCGCGCGAGCACGCGCCGGCGAAATCGATCCCGTTATC
GGCCGCGAGCTGGAAATCCGCACCATGGTCGACGTGCTGCTGCGTCGGCGGCAGAACAATCCGCTGATCA
CCGGCGAGGCCGGTGTCGGCAAGACCGCGATGGTGGAGGGGTTGGCGCATGCGATCGCCGCGGGCAACGT
GCCGCCGAATCTGGCCGACGTGCGATTGCTGAGCCTCGATGTCGGCGCGCTGCTGGCGGGCGCCAGCATG
AAGGGCGAATTCGAGGCGCGCTTGAAGGGCGTCCTCGAGGCCGCAGCACGCTCCGCGGCGCCCATCATCC
TGTTCGTCGACGAAATCCATACGCTGATCGGCGCAGGCGGGCAAGCCGGCACCGGCGACGCCGCGAACCT
CCTGAAACCGGCGCTCGCGCGCGGCACGATCCGCACTATCGGCGCGACGACCTGGGCCGAATACAAGCGG
CATATCGAGAAGGATCCCGCGCTGACGCGGCGCTTTCAGGTGTTGCAGGTCGCGGAGCCGTCCGAAGCGG
CGGCGGCCGACATGGTGCGCGGCCTCGCGTCGACGTTTTCGTCGCATCACGGCGTCGTCGTGCGGGACGA
AGCGATCCGCGCAGCAGTAACGCTGTCGCATCGTTACATTCCGTCGCGTCAATTGCCGGACAAGGCGATC
AGCCTGCTCGACACCGCATGCGCGCGCGTCGCGCTGTCGCAGCACGCGACGCCGCGCGAACTCGACGACG
TGCGGCAGCGCCTGGCTGCCGCGCGCACCGAAGAAACGCTGCTGGTACAGGAGGCCCGTATCGGTCTCGA
AGCGGACAAGGCGCTGCATCGCGTGCGCACGCGCATCGACGCACTGGCGACGGAAGAAGCGGCACTCGCG
GATCGCTGGCGCGCACAGGCGCAGGCCGCGCAGGCGTTGCTTTCCGCGCGCGAAGCCGCGATCGCGGACG
AGCGCGATTCGCCGGTATCGCTCGACAGCTTGCGTGAGCTCGAACGGACGCTGGTCGCGCTGCAGGGCGA
CGCGCCGCTCGTCTTTCCCGAAGTGGACGCCGCCATCGTCGCCGAGATCGTATCGGACTGGACCGGCATC
CCGGTCGGTCGCATGGTCACCGACGAGATCGTCGCCGTGCGCCGCCTTCCGGAAACGCTCGCGGTCCGCG
TGATCGGGCAGAGCGATGCGCTGAACCTGATCGGCGAACGTGTGCAGACCGCGCGGTCGGGGCTGACCGA
TCCGAACAAGCCGCTGGGCGTGTTTCTGCTGGCGGGGCCGTCCGGCGTCGGCAAGACCGAGACGGCGCTG
GCGCTGGCCGAGGCGCTATACGGCGGCGAGCAGAACCTGATCACGATCAACATGAGCGAGTACCAGGAGG
CCCACACCGTGTCGGGCCTGAAAGGCGCGCCGCCCGGCTATGTCGGCTACGGCGAGGGCGGTGTGCTGAC
CGAAGCGGTGCGCCGGCGGCCCTACGCGGTCGTGTTGCTCGACGAGATCGAAAAGGCGCATCGCGACGTG
CACGAAATGTTCTTCCAGGTGTTCGACAAGGGCTACATGGAAGACGGCGACGGTCGCCATATCGACTTCC
GCCATACCACCATCCTGCTGACGAGCAACGTCGGCGCCGAGCTTGGCGCGAGCCTGTGTGCCGATCCGGC
GCTGGCACCGGATCTCGACGGCCTGCGCGACGCGCTGGCACCGGAACTGCTGAAGGTATTCCCGGCGGCG
TTCATGGGGCGTGTGACCGTTGTGCCGTACCGGCCGCTCGCCGCCGACGCGCTCGCGAGCATCGTCCGCC
TGCATCTGGACCGCGTCGCGAAACGCATGGCACACACCCACGACATCGCGCTCGTCTGCGACGACGCAGT
CGTGCATTACATCGTCGGCCGTTGCCTCGTTCAGGAGACGGGCGCGCGCGTGCTGATCGGCTTCATCGAA
CAGCATGTGCTGCCGCGCCTTTCCGCGCTCTGGCTCGATGCGTTCGCATCGCGCGTGCCGCTCGCGCGCA
TCGCGATCGGCGTAACCGATTCCTCCGCGTCGCCCGCACAGGCGCTGACGTTCGAGGCCACCCCTTCTCA
TCCTCTCGAGCCGCGTCGTTGA