SecReT6
Protein ID: 161520455
SecReT6 ID241
T6SS typei3
Gene symbol-
Locus tagBmul_3907
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome II [GenBank: NC_010086] [Browse all T6SS(s) in this replicon]
Location [Strand]874441..874980 [+]
Producttype VI secretion protein
NoteTssB
UniProt IDA9APY7
KEGG IDbmu:Bmul_3907, bmj:BMULJ_04594
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 3.40E-60, Aligned region: 10..164
Protein Sequence: 179 a.a.     [Download]
>gi|161520455|ref|YP_001583882.1| type VI secretion protein [Burkholderia multivorans ATCC 17616] [TssB]
MSASNSQKFIARNRAPRVQIEYDVEVYGSEKKVELPFVMGVLADLSGKHPVEPLPAVSERRFLEIDIDNF
DERMKAIRPRVAFAVPNTLTGEGQMMVDMTFESMEDFSPAAIADKVEPLRRLLQARTQLANLQTYMDGKS
GAEALVTQLLQDPALLKSLAAAPRSERHEADAADSANAS
 
Nucleotide Sequence: 540 bp     [Download]
>gi|161519706|ref|NC_010086.1|:874441-874980 Burkholderia multivorans ATCC 17616 chromosome 2, complete sequence [TssB]
ATGTCCGCTAGCAATTCGCAGAAGTTCATCGCGCGCAATCGTGCGCCGCGTGTGCAGATCGAGTACGACG
TCGAAGTGTATGGCTCGGAGAAGAAAGTCGAGCTTCCGTTCGTGATGGGCGTACTTGCCGACCTCTCCGG
CAAGCATCCGGTCGAGCCGCTGCCGGCGGTGTCCGAGCGCCGGTTTCTGGAAATCGACATCGACAACTTC
GACGAGCGCATGAAGGCGATCCGGCCGCGCGTCGCGTTTGCCGTGCCGAATACGCTGACGGGCGAAGGCC
AGATGATGGTCGACATGACCTTCGAAAGCATGGAGGACTTCTCGCCGGCCGCGATCGCCGACAAGGTCGA
GCCGCTGCGCCGCCTGCTCCAGGCGCGTACGCAGCTGGCGAACCTGCAGACGTACATGGACGGCAAGTCG
GGCGCCGAGGCGCTCGTCACCCAGCTGCTGCAGGACCCGGCGCTGCTGAAGTCGCTGGCTGCGGCGCCGC
GGTCGGAGCGGCACGAAGCGGACGCGGCCGATTCCGCCAACGCGAGCTGA