SecReT6
Protein ID: 161520456
SecReT6 ID241
T6SS typei3
Gene symbol-
Locus tagBmul_3908
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome II [GenBank: NC_010086] [Browse all T6SS(s) in this replicon]
Location [Strand]875008..876501 [+]
ProductEvpB family type VI secretion protein
NoteTssC
UniProt IDA9APY8
KEGG IDbmu:Bmul_3908, bmj:BMULJ_04593
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 4.00E-194, Aligned region: 65..491
Protein Sequence: 497 a.a.     [Download]
>gi|161520456|ref|YP_001583883.1| EvpB family type VI secretion protein [Burkholderia multivorans ATCC 17616]
MAKQQVHAVEAQAATQSDFTQLLEREFRPKTDQARAAVEHAVQTLAEQALTQSITISDDAYKSIAAIIAQ
IDRKLSEQINLILHHDDYQALESAWRGLNHLVSNTETDEHLKIRVMDVSKAELHRTMRRYKGLAWDQSPL
FKQIYEQEYGQLGGEPYGCIVADYYFDHTPPDVDLLGSIAKVAAAAHTPFVTGAAPSVLQMESWQELANP
RDLTKIFTQNLEYTAWNSLRNTEDARYVGLAMPRFLARLPYGAKTNPVDQFDFEEDTNGSDHSRYGWANA
AYAMGVNINRSFKQYGWCSLIRGVESGGTVDNLPCHTFPTDDGGVDMKCPTEIAISDRREAELSKNGFIP
LVHRKNTDHATFIGAQSLQKPAEYHDPDATANANLSARLPYLFACSRFAHYLKCIVRDKIGAFKEREDMQ
RWLNEWIMNYVDADPANSSQDTKARRPLAAAEVLVEDVEGNPGYYQAKFFLRPHFQLEGLTVSLRLVTKL
PSIKEAA
 
Nucleotide Sequence: 1494 bp     [Download]
>gi|161519706|ref|NC_010086.1|:875008-876501 Burkholderia multivorans ATCC 17616 chromosome 2, complete sequence
ATGGCAAAACAGCAAGTACACGCCGTCGAGGCGCAGGCCGCGACCCAATCCGATTTCACGCAACTGCTCG
AACGGGAATTCCGGCCGAAGACGGATCAGGCCCGCGCGGCGGTGGAACATGCGGTGCAGACACTCGCGGA
GCAGGCGCTCACGCAGTCGATCACGATCAGCGACGACGCCTACAAGAGCATCGCGGCGATCATCGCGCAG
ATCGATCGCAAGCTCTCCGAGCAAATCAACCTGATCCTGCATCATGACGACTACCAGGCGCTCGAATCCG
CGTGGCGCGGCCTGAACCATCTCGTGTCGAACACCGAGACGGACGAGCACCTGAAGATCCGCGTGATGGA
TGTCTCGAAGGCCGAACTGCATCGTACGATGCGGCGCTACAAGGGGCTGGCGTGGGATCAGAGCCCGCTT
TTCAAGCAGATCTACGAACAGGAATACGGGCAGCTCGGCGGCGAGCCGTACGGGTGCATCGTGGCCGACT
ACTACTTCGACCACACGCCGCCGGACGTCGACCTGCTCGGTTCGATCGCGAAGGTGGCGGCGGCCGCGCA
CACGCCGTTCGTGACCGGTGCGGCGCCTTCGGTGCTGCAGATGGAATCGTGGCAGGAACTGGCGAACCCG
CGCGACCTGACGAAGATCTTCACGCAGAACCTCGAATACACCGCGTGGAATTCGTTGCGCAACACCGAGG
ACGCGCGCTACGTCGGCCTTGCGATGCCGCGCTTCCTGGCGCGGCTGCCGTACGGCGCGAAGACCAATCC
GGTCGACCAATTCGATTTCGAGGAAGACACGAACGGCTCCGACCACAGCCGCTACGGTTGGGCGAACGCG
GCGTATGCAATGGGCGTCAACATCAACCGCTCGTTCAAGCAGTACGGCTGGTGCTCGCTGATCCGCGGCG
TCGAATCGGGCGGCACGGTCGACAACCTGCCGTGCCATACGTTCCCGACCGACGACGGCGGCGTCGACAT
GAAGTGCCCGACCGAGATCGCGATCTCGGATCGTCGCGAGGCCGAGCTGTCGAAGAACGGCTTCATTCCG
CTCGTGCATCGCAAGAATACCGATCACGCGACCTTCATCGGCGCCCAGTCGCTGCAGAAACCGGCCGAGT
ATCACGACCCCGACGCAACCGCGAATGCGAATCTGTCGGCGCGCCTGCCGTACCTGTTCGCCTGCTCGCG
CTTCGCGCATTACCTGAAGTGCATCGTGCGCGACAAGATCGGCGCATTCAAGGAGCGCGAAGACATGCAG
CGCTGGCTCAACGAATGGATCATGAACTACGTCGACGCCGACCCCGCGAACTCGTCGCAGGACACGAAGG
CACGCCGGCCGCTCGCTGCGGCCGAGGTGCTGGTCGAGGACGTCGAAGGCAATCCCGGCTACTACCAGGC
GAAGTTCTTCCTGCGTCCGCACTTCCAGCTCGAAGGACTGACCGTTTCGCTGCGGCTCGTGACGAAGCTG
CCGTCGATCAAGGAAGCCGCTTAA