SecReT6
Protein ID: 161520457
SecReT6 ID241
T6SS typei3
Gene symbol-
Locus tagBmul_3909
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome II [GenBank: NC_010086] [Browse all T6SS(s) in this replicon]
Location [Strand]876594..877079 [+]
ProductHcp1 family type VI secretion system effector
NoteTssD
UniProt IDA9AQ69
KEGG IDbmu:Bmul_3909, bmj:BMULJ_04592
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 2.00E-43, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|161520457|ref|YP_001583884.1| Hcp1 family type VI secretion system effector [Burkholderia multivorans ATCC 17616]
MAQDIFLKIDGINGESLDDKHKDEIEILNWDWEILQESSMHSGSGGGAGKATVKDLTFEHNIDRASPNLM
KYALTGKHIDQAVLVMRKAGGNPLEYLKLTMSDVIVTRVKPSGSKAGEEKSRETVSLSFSKVKQEYVVQN
AQGGSGGAVTASFDIKGNKEA
 
Nucleotide Sequence: 486 bp     [Download]
>gi|161519706|ref|NC_010086.1|:876594-877079 Burkholderia multivorans ATCC 17616 chromosome 2, complete sequence
ATGGCACAGGACATTTTTCTGAAGATCGACGGCATCAACGGCGAATCGCTCGACGACAAGCACAAGGACG
AGATCGAGATCCTGAACTGGGATTGGGAAATCCTGCAGGAATCGTCGATGCATTCGGGTAGCGGCGGCGG
CGCCGGGAAGGCGACCGTCAAGGATCTCACGTTCGAGCACAACATCGACCGCGCGAGTCCGAACTTGATG
AAGTACGCGCTGACGGGCAAGCACATCGACCAGGCCGTGCTGGTGATGCGCAAGGCCGGCGGCAACCCGC
TCGAATACCTGAAGCTCACGATGAGCGACGTGATCGTCACGCGCGTGAAGCCGTCGGGCAGCAAGGCCGG
CGAGGAAAAGAGCCGCGAGACGGTGTCCCTGTCGTTCTCGAAGGTGAAGCAGGAGTATGTCGTGCAGAAC
GCGCAGGGCGGAAGCGGCGGCGCCGTCACGGCGAGCTTCGACATCAAGGGCAACAAGGAAGCGTAA