SecReT6
Protein ID: 161520458
SecReT6 ID241
T6SS typei3
Gene symbol-
Locus tagBmul_3910
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome II [GenBank: NC_010086] [Browse all T6SS(s) in this replicon]
Location [Strand]877158..877661 [+]
Producthypothetical protein
NoteTssJ
UniProt IDA9AQ70
KEGG IDbmj:BMULJ_04591, bmu:Bmul_3910
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 6.60E-42, Aligned region: 13..159
Protein Sequence: 167 a.a.     [Download]
>gi|161520458|ref|YP_001583885.1| hypothetical protein Bmul_3910 [Burkholderia multivorans ATCC 17616]
MRSILTAASLAVVVLLSACASGEPKPKAPIRLELAINAASDVNPDDRGHAAPIVVRLYELKNGSAFEAAD
FFSLETQEKTVLAADVVKRDQFQLRPGEHRKVVRRPDRETTAIGVIAAYRDLPNAVWRSVYTMPVAPDKA
WYRLVTPKLKLTVDLSAKAVTIEERKK
 
Nucleotide Sequence: 504 bp     [Download]
>gi|161519706|ref|NC_010086.1|:877158-877661 Burkholderia multivorans ATCC 17616 chromosome 2, complete sequence
ATGCGTTCGATTCTGACCGCCGCTTCGCTCGCCGTCGTCGTACTGCTCTCGGCCTGCGCGAGCGGCGAAC
CGAAGCCGAAGGCGCCGATTCGGCTCGAACTGGCCATCAACGCGGCATCCGACGTGAATCCGGACGATCG
CGGGCACGCGGCGCCGATCGTGGTGCGTCTCTACGAGCTGAAGAACGGCAGCGCATTCGAAGCGGCGGAT
TTCTTTTCGCTGGAAACACAGGAGAAGACGGTGCTGGCGGCCGACGTCGTCAAGCGCGACCAGTTCCAGT
TGCGCCCCGGCGAGCATCGGAAGGTTGTCCGGCGGCCCGATCGGGAAACGACTGCCATCGGCGTGATCGC
GGCCTATCGCGATCTGCCGAATGCGGTATGGCGGTCGGTCTACACGATGCCTGTCGCGCCCGACAAGGCG
TGGTACCGGCTTGTTACACCGAAGCTGAAACTGACTGTCGATCTCTCGGCCAAGGCCGTCACGATCGAGG
AAAGGAAGAAATGA