SecReT6
Protein ID: 161520461
SecReT6 ID241
T6SS typei3
Gene symbol-
Locus tagBmul_3913
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome II [GenBank: NC_010086] [Browse all T6SS(s) in this replicon]
Location [Strand]879239..880489 [+]
Producttype VI secretion protein
NoteTssK
UniProt IDA9AQ73
KEGG IDbmu:Bmul_3913, bmj:BMULJ_04588
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.00E-133, Aligned region: 5..415
Protein Sequence: 416 a.a.     [Download]
>gi|161520461|ref|YP_001583888.1| type VI secretion protein [Burkholderia multivorans ATCC 17616]
MGSVQLSPFFFGFVHYALDLESLALGKVIVKSAAGVFADGTPFDAPGNTPLPPPLTIRPEHLDQVIYLAV
PVRLPNCEETTFEDTPDSMARYQVFDAELRDSNSVGLAPESVQLSNLRLRLVPEKELGNAWIGLALTSVK
TIRADGSIELDDTIVPPVSGYGASDLLTSWVTKIHDLAHLRANALSQRLAGTDDTTASAATVTDYLLLQI
LNRYEPLLQHMLRVPTTSPAEVYTLLIAMAGELSTHLRTDTRRPLDTHPPYRHTAPHLCLKPLVDDTHRL
LNAVLVRSAQSIALEDRGHGMRNAVVDPADMRGFASLVLAVHAAMPPDVLRQQFLAQAKAGPSEKLPSLV
RSHLPGIGMQALPVPPRQIPFNAGYIYYELTQGGALWEEVVRHGGIALHVAGEFPSLKLELWGVRA
 
Nucleotide Sequence: 1251 bp     [Download]
>gi|161519706|ref|NC_010086.1|:879239-880489 Burkholderia multivorans ATCC 17616 chromosome 2, complete sequence
GTGGGGTCAGTTCAGCTGTCGCCGTTTTTCTTCGGTTTCGTGCATTACGCGCTCGATCTGGAGTCGCTCG
CGCTCGGGAAGGTGATCGTCAAATCGGCCGCCGGCGTGTTCGCCGACGGTACGCCATTTGACGCGCCGGG
CAATACGCCGCTGCCGCCGCCGTTGACGATCCGTCCGGAACACCTCGACCAGGTGATCTATCTGGCCGTG
CCGGTACGTTTGCCGAACTGCGAGGAAACGACGTTCGAGGATACGCCCGATTCGATGGCGCGCTATCAGG
TGTTCGATGCCGAGCTGCGCGACTCGAATTCGGTCGGGCTGGCGCCCGAGTCCGTCCAGCTGTCGAACCT
GCGGCTGCGTCTGGTGCCGGAGAAGGAGCTCGGCAACGCATGGATCGGACTTGCGCTGACGAGCGTAAAG
ACCATTCGCGCGGACGGCAGCATCGAACTGGACGACACGATCGTGCCGCCCGTATCGGGCTATGGCGCGA
GCGATTTGCTGACGAGCTGGGTCACGAAGATCCACGATCTCGCTCATCTGCGCGCGAATGCGCTGTCGCA
GCGGCTGGCCGGCACGGACGACACGACCGCAAGTGCGGCGACGGTCACGGATTACCTGCTGTTGCAGATC
CTCAACCGGTACGAGCCGTTGCTGCAGCACATGCTGCGCGTGCCGACCACGTCGCCGGCTGAGGTCTACA
CGCTGCTGATCGCGATGGCGGGCGAGCTGTCGACCCATCTACGCACGGATACGCGCCGGCCGCTCGATAC
GCATCCGCCTTATCGGCATACGGCGCCGCATCTTTGCCTGAAGCCGCTGGTGGACGACACGCACCGGCTG
CTCAATGCCGTGCTCGTGCGTAGCGCGCAGAGCATCGCGCTCGAGGATCGGGGGCACGGCATGCGGAATG
CGGTGGTCGATCCGGCCGATATGCGGGGTTTCGCTTCGCTGGTGCTCGCCGTGCATGCGGCGATGCCGCC
GGACGTGCTGCGTCAGCAGTTTCTCGCGCAAGCGAAGGCGGGGCCGTCGGAAAAGCTGCCGAGCCTCGTG
CGCAGTCATTTGCCGGGTATCGGCATGCAGGCGCTGCCGGTGCCGCCGCGGCAGATTCCGTTCAACGCGG
GATATATCTATTACGAGCTGACACAGGGCGGGGCGCTGTGGGAGGAGGTGGTGCGTCACGGTGGGATCGC
GTTGCATGTGGCGGGGGAGTTTCCGTCACTCAAGCTGGAACTTTGGGGTGTGCGTGCGTAA