SecReT6
Protein ID: 161520462
SecReT6 ID241
T6SS typei3
Gene symbol-
Locus tagBmul_3914
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome II [GenBank: NC_010086] [Browse all T6SS(s) in this replicon]
Location [Strand]880551..883088 [+]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDA9AQ74
KEGG IDbmu:Bmul_3914, bmj:BMULJ_04587
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 4.80E-72, Aligned region: 35..379
DUF2345 [PF10106], Evalue: 1.20E-49, Aligned region: 663..814
T6SS_Vgr [PF13296], Evalue: 1.40E-34, Aligned region: 524..633
Phage_base_V [PF04717], Evalue: 7.30E-18, Aligned region: 69..95
Phage_base_V [PF04717], Evalue: 7.30E-18, Aligned region: 262..310
Phage_base_V [PF04717], Evalue: 7.30E-18, Aligned region: 432..512
Protein Sequence: 845 a.a.     [Download]
>gi|161520462|ref|YP_001583889.1| ImpA family type VI secretion-associated protein [Burkholderia multivorans ATCC 17616]
MALFDASRTLSVSGAALPTYGGQSLLTPVKLTGAETIGELFEYVLELKTPDALAFSPSIAANVDLDALIG
TEVTVSIQLEGRGHFIPGLAGGAGMGNIGAGMREITGIVSQATIVREDGRSIVYALTLRPWLWHATKNCD
CRIFQDMSVVEITDAVLSIYPFPVDKRLTTPRPNKVWPKRDIQRQHFESDWAFLQRLWEEWGIYYFFEHG
EGKHRLVLCDSMGALRPLGDAYAELRYEPPTSRRIDEEHIHEFSVSHALTTGAVTAVDYDYTLPRANLTV
TREDPRDTGLAHQERYSWGDYAQPQAGAAGLSGAHNEPRTEAEYLTLVQMQAWRCQGLTAQGKGNLRGMV
AGQTFVLSHYPQEAANREYAVIACRLMIEEIGEASGAGQQYRCEADFTVQPTNEPFRLLRTIAKPRMNGI
EYAVVTCPDNQEIWTDAYGRVKLQFLWDRLGKNDERSSCWVRVAGAWHGDQFGGVFLPRRGQEVEVAFVN
GDPDLPIVVGSAANAFNMPPFALPANQALAGYRSKEIGGRRANTLAFDDTNGKIQAHLSSDEGCSQLNLG
YITRIAGNAGRQEERGRGFELATSLWGVVRSALGMLITTEAPSNAQSHAKEMDETVRRLAEARDTHERLA
GLAQQNGGQEPNGDQSEVTAALRVQNDAIRGDATTEGHPFPEFAEPHMTLASPAGIETTTAGSTHIASGE
HLALTTGEHLGIATGRSLFATVKEKLRIFVYHAGIKLISGAGSIDIEALKDAINLMAKIRIRQTATKIEI
WAEEELSLRGGKSFITLSNAGITNGTPGQWQSYAATHEMPGPRSAPDDIPAAELKVCELSTIKAAARHAA
IVPLR
 
Nucleotide Sequence: 2538 bp     [Download]
>gi|161519706|ref|NC_010086.1|:880551-883088 Burkholderia multivorans ATCC 17616 chromosome 2, complete sequence
ATGGCTTTGTTTGACGCATCACGGACGCTATCGGTTTCCGGCGCGGCGCTGCCGACGTACGGTGGCCAAT
CGCTCCTGACGCCGGTGAAGCTCACGGGTGCCGAGACGATAGGCGAGTTGTTCGAATACGTCCTGGAACT
GAAGACACCAGACGCGCTCGCGTTCTCCCCGAGCATCGCGGCGAACGTCGATCTCGATGCGTTGATCGGC
ACGGAGGTGACCGTATCGATTCAGCTCGAAGGCCGTGGGCATTTCATTCCGGGCCTTGCCGGTGGTGCCG
GCATGGGAAATATCGGCGCAGGCATGCGCGAGATCACCGGCATTGTCAGTCAGGCGACGATCGTTCGCGA
AGACGGCCGCTCGATTGTGTACGCACTGACGCTGCGGCCGTGGCTCTGGCATGCGACTAAAAATTGCGAC
TGCCGCATTTTCCAGGACATGTCGGTTGTCGAGATCACGGATGCCGTGCTGTCGATCTATCCGTTTCCGG
TCGATAAACGGCTGACGACGCCTCGGCCTAACAAGGTATGGCCCAAGCGCGACATTCAGCGCCAGCATTT
CGAAAGCGACTGGGCGTTCCTGCAGCGCTTGTGGGAAGAGTGGGGTATCTACTACTTCTTCGAGCATGGC
GAAGGCAAGCATCGGCTCGTGCTTTGCGATTCGATGGGCGCGCTCCGGCCGCTCGGCGACGCCTATGCCG
AGCTTCGCTACGAACCGCCGACCAGTCGGCGCATCGACGAGGAGCATATCCACGAATTCTCGGTGTCACA
TGCGCTGACCACGGGCGCGGTGACGGCTGTCGACTACGACTACACGTTGCCGCGAGCGAATCTGACCGTG
ACGCGGGAGGATCCCCGCGATACGGGCCTCGCCCATCAGGAGCGCTATTCGTGGGGCGACTATGCACAGC
CGCAAGCGGGGGCGGCCGGACTCTCCGGCGCGCACAACGAGCCGCGCACCGAAGCGGAATACCTCACGCT
GGTACAGATGCAGGCCTGGCGGTGTCAGGGATTGACGGCGCAAGGCAAGGGCAATTTGCGCGGCATGGTC
GCCGGGCAGACGTTCGTGCTGTCGCACTACCCGCAAGAGGCGGCGAATCGCGAGTACGCGGTGATTGCGT
GCCGGCTGATGATCGAAGAGATCGGCGAAGCGTCCGGGGCGGGTCAGCAGTATCGGTGCGAAGCGGATTT
CACCGTGCAACCGACCAATGAGCCGTTTCGTCTATTGCGCACGATAGCGAAGCCGCGCATGAACGGCATC
GAGTATGCCGTCGTGACGTGCCCCGACAACCAGGAAATCTGGACCGATGCCTACGGGCGCGTGAAGCTGC
AGTTTCTCTGGGATCGGCTAGGCAAGAACGACGAGCGTTCCAGTTGTTGGGTGCGCGTTGCCGGCGCCTG
GCACGGCGATCAGTTCGGCGGCGTTTTTCTTCCGCGTCGGGGGCAGGAGGTCGAGGTTGCCTTCGTCAAT
GGCGATCCGGACTTGCCGATCGTCGTGGGAAGCGCGGCGAACGCCTTCAACATGCCGCCGTTCGCGTTGC
CGGCGAATCAGGCGCTCGCCGGCTACCGCAGCAAGGAAATCGGCGGCCGTCGAGCGAATACGCTGGCTTT
CGACGATACGAACGGCAAGATCCAGGCGCATCTGTCGAGCGATGAAGGGTGTTCGCAGTTGAATCTGGGG
TACATCACGCGTATTGCGGGGAATGCGGGGCGGCAGGAGGAAAGGGGAAGGGGGTTTGAACTTGCGACCA
GTCTATGGGGAGTAGTGAGATCGGCATTGGGAATGCTGATCACGACCGAGGCGCCATCGAATGCGCAAAG
CCATGCGAAAGAAATGGACGAAACAGTTCGGCGACTCGCGGAAGCGCGAGACACCCACGAACGGCTGGCT
GGACTGGCTCAGCAGAATGGCGGGCAGGAACCGAACGGTGACCAAAGCGAAGTTACGGCCGCGCTGAGAG
TACAGAACGATGCGATACGAGGGGACGCAACGACGGAGGGCCACCCATTTCCCGAGTTTGCTGAGCCGCA
TATGACGCTTGCCAGTCCGGCGGGCATCGAAACGACGACGGCGGGCAGTACACACATCGCGAGCGGTGAA
CATCTGGCATTGACGACTGGCGAACATCTTGGCATTGCCACAGGGCGATCACTGTTTGCGACCGTCAAGG
AGAAACTGAGAATTTTCGTATACCACGCCGGGATCAAACTCATTTCCGGTGCTGGTTCAATTGACATTGA
AGCTCTCAAGGATGCCATTAACCTGATGGCAAAAATCCGGATCAGGCAAACCGCGACGAAAATTGAAATC
TGGGCGGAAGAAGAGTTGTCGCTTCGTGGCGGGAAGAGCTTCATTACGCTCAGTAACGCGGGGATTACCA
ACGGTACGCCGGGGCAGTGGCAATCGTATGCCGCAACGCACGAGATGCCGGGACCAAGAAGCGCACCCGA
TGACATTCCGGCTGCCGAACTCAAGGTATGTGAACTGAGCACGATCAAAGCGGCTGCTCGGCACGCCGCG
ATCGTGCCGCTTCGGTGA