SecReT6
Protein ID: 161520469
SecReT6 ID241
T6SS typei3
Gene symbol-
Locus tagBmul_3921
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome II [GenBank: NC_010086] [Browse all T6SS(s) in this replicon]
Location [Strand]889798..891093 [+]
Producthypothetical protein
NoteTssL
UniProt IDA9AQ81
KEGG IDbmj:BMULJ_04580, bmu:Bmul_3921
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 7.50E-67, Aligned region: 56..265
OmpA [PF00691], Evalue: 1.70E-17, Aligned region: 325..423
Protein Sequence: 431 a.a.     [Download]
>gi|161520469|ref|YP_001583896.1| hypothetical protein Bmul_3921 [Burkholderia multivorans ATCC 17616]
MSRAKYLAGERHDVTVAVDVPTFADIVDSDRNRKTYVIPPGEAESQRLNAIRLARNPLLEAARPLLRAQA
DMPDTLAGPASELLRKMLEHELRIFQKLCEQANIRRDHMIGARYCLCTALDEAAMRTEWGRSGSSGCEWG
NRSLATTFHEDRDGGEKVYLLIGRLMQAPDEHRDLLEVIYRILSLGFEGRYQDVADGKRKHDAIRQRLYT
EITSQRDPVPLTLSRHWQPGTKGKRPSFYDFPVWITATLLSVVLLGLFGWFKYELSNHSADVQKQIADIA
RMTPPPAPPPQLHLKQLLKDEIAAGTVSVDEDARRSVVTFRGDAMFRPGGASVQASMNPLIAKIAAEIAK
VPGKVTIVGYTDNVPIRSGQFASNQALSEERATQVMQMLQAAGVPANRLEAVGKGDADPVGDNRTAQGRA
QNRRVEIDVAR
 
Nucleotide Sequence: 1296 bp     [Download]
>gi|161519706|ref|NC_010086.1|:889798-891093 Burkholderia multivorans ATCC 17616 chromosome 2, complete sequence
ATGAGCCGCGCGAAATACCTGGCTGGCGAAAGACACGATGTAACGGTTGCCGTCGACGTTCCGACGTTCG
CAGATATCGTCGATTCCGACCGAAACAGGAAGACTTACGTGATTCCACCGGGCGAAGCAGAGTCGCAGAG
ACTGAATGCGATCAGGCTGGCGCGGAATCCTTTGCTTGAGGCAGCGCGTCCGCTATTGAGAGCGCAGGCG
GATATGCCCGACACCCTGGCAGGTCCTGCAAGTGAGCTTCTGCGCAAGATGCTGGAGCACGAGCTGCGCA
TCTTTCAGAAACTGTGCGAGCAGGCCAACATTCGCCGCGATCATATGATCGGCGCACGATACTGCCTCTG
CACGGCGCTTGACGAGGCCGCGATGAGGACAGAGTGGGGCCGCAGTGGATCTTCCGGGTGCGAATGGGGT
AACCGCAGCCTTGCGACAACATTCCATGAGGATCGCGACGGCGGTGAAAAAGTTTATCTGCTGATCGGCC
GGCTGATGCAGGCGCCTGACGAGCATCGCGATCTGCTGGAGGTGATTTATCGGATCCTCAGTCTAGGCTT
TGAAGGACGCTACCAGGACGTTGCCGACGGCAAGCGCAAGCACGACGCCATTCGCCAACGGCTTTACACC
GAAATCACATCGCAACGCGACCCCGTGCCGTTGACTTTGTCCCGCCACTGGCAACCCGGCACAAAGGGCA
AGCGCCCGTCGTTCTACGATTTCCCCGTGTGGATTACCGCAACGCTTTTGTCGGTGGTCCTGCTCGGCCT
GTTCGGATGGTTCAAGTACGAACTCTCCAATCACAGCGCGGACGTTCAGAAGCAGATTGCCGACATTGCC
CGCATGACGCCGCCGCCTGCGCCGCCGCCGCAACTGCACCTCAAGCAGTTGCTCAAGGATGAAATCGCCG
CCGGCACGGTCAGCGTCGACGAGGACGCTCGCCGCAGCGTCGTCACGTTCCGCGGCGACGCGATGTTCCG
GCCCGGTGGCGCCTCTGTCCAGGCCTCGATGAATCCGCTGATCGCGAAGATCGCGGCAGAGATCGCCAAG
GTTCCCGGCAAGGTCACGATCGTCGGCTACACGGACAACGTGCCGATTCGCAGCGGCCAGTTCGCGTCGA
ATCAGGCGCTGTCGGAAGAGCGGGCCACCCAGGTCATGCAGATGCTGCAAGCCGCTGGCGTACCGGCGAA
CCGCCTGGAAGCCGTCGGCAAGGGCGATGCCGATCCGGTCGGCGACAACCGCACCGCGCAGGGCCGCGCG
CAAAACCGCCGTGTCGAGATCGACGTCGCACGATAA