SecReT6
Protein ID: 161520471
SecReT6 ID241
T6SS typei3
Gene symbol-
Locus tagBmul_3923
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome II [GenBank: NC_010086] [Browse all T6SS(s) in this replicon]
Location [Strand]895239..896456 [+]
ProductDotU family type IV/VI secretion system protein
NoteTssL
UniProt IDA9AQ83
KEGG IDbmu:Bmul_3923, bmj:BMULJ_04578
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 4.10E-49, Aligned region: 32..245
OmpA [PF00691], Evalue: 4.70E-12, Aligned region: 314..397
Protein Sequence: 405 a.a.     [Download]
>gi|161520471|ref|YP_001583898.1| DotU family type IV/VI secretion system protein [Burkholderia multivorans ATCC 17616]
MSLITADPQSHGGSLASPSVATRLKRAEQSVNPLLEAARVLLSALADTPDVLDADSIARRRRWLEHELRL
FARLGAELGLSPEHIRSASYCLCSALDESAMQTRWGKGEATGVAWEVDGLAAAMGHDRQAGDRVFQLIDE
ALCSPREDLDLIELYQNILDLGFRGRYRFERDGQQRLTRVRERVHDVVVTGGVGANFARESLRQRRRTVD
PWVRPLARRRSSRVGAVVAITAALLLGAAGYAAVDRWVVSREAQRLSPFDALARNLERRLRDEVAAGNVE
LIRDPARHVLTLRFAGMFVPGAVTVAPWGASVVASAGREIASIAEGMVVRVVGYADSAPAGSARQVSNQA
LSEARAEDVARILVAAGVPAHGLRVEGRGDADALADNGTESGRARNRRVEVIVAE
 
Nucleotide Sequence: 1218 bp     [Download]
>gi|161519706|ref|NC_010086.1|:895239-896456 Burkholderia multivorans ATCC 17616 chromosome 2, complete sequence
ATGAGTCTGATAACAGCCGATCCGCAAAGCCACGGCGGGAGCCTGGCGTCGCCGTCCGTCGCGACGAGGC
TCAAGCGGGCGGAGCAGTCGGTCAACCCGCTGCTCGAAGCGGCGCGCGTCCTGTTGAGCGCGTTGGCAGA
TACGCCCGATGTGCTCGATGCCGATTCGATAGCCCGGCGGCGACGGTGGCTCGAGCATGAACTCCGGCTA
TTTGCGCGGCTCGGCGCTGAACTCGGGCTTTCGCCGGAGCATATCCGGAGCGCCAGCTACTGCCTGTGTT
CGGCGCTCGACGAGTCTGCGATGCAGACGCGCTGGGGCAAAGGAGAGGCAACCGGTGTCGCATGGGAAGT
CGATGGGCTCGCCGCGGCGATGGGTCACGACCGTCAGGCCGGCGACCGCGTTTTCCAGCTGATCGACGAG
GCGTTATGCAGCCCGCGCGAGGACCTTGATCTGATCGAGCTGTACCAGAACATCCTCGATCTCGGCTTTC
GCGGGCGTTATCGATTCGAGCGCGACGGACAGCAGCGCTTGACGCGCGTTCGCGAGCGCGTGCACGACGT
GGTCGTGACGGGCGGGGTGGGCGCGAATTTCGCAAGGGAGTCGCTTCGACAAAGGCGGCGCACGGTCGAC
CCTTGGGTGCGTCCATTGGCGAGGCGGCGATCGTCGCGCGTCGGGGCTGTCGTCGCCATAACCGCGGCGT
TGCTGCTCGGAGCCGCCGGATATGCCGCTGTGGACCGTTGGGTCGTGTCGAGAGAGGCGCAACGCCTGTC
GCCGTTCGACGCGCTGGCTCGCAATCTGGAACGGCGGCTCCGTGACGAGGTCGCAGCAGGGAATGTCGAA
CTGATCCGGGATCCCGCACGCCATGTCTTGACGCTCCGCTTTGCCGGCATGTTCGTACCGGGCGCGGTAA
CGGTGGCGCCTTGGGGTGCTTCCGTCGTGGCGTCGGCTGGCCGGGAAATTGCGTCGATCGCTGAAGGTAT
GGTCGTCAGGGTAGTGGGATACGCGGACAGCGCGCCGGCCGGGTCCGCGCGTCAGGTCTCCAATCAGGCA
CTTTCCGAAGCACGTGCCGAAGATGTCGCCCGGATTCTTGTCGCGGCCGGCGTACCGGCGCATGGCCTCC
GCGTGGAAGGGCGCGGGGATGCAGACGCGTTGGCGGACAACGGTACCGAGTCGGGAAGGGCGAGGAATCG
GCGCGTCGAAGTGATCGTCGCGGAATAA