SecReT6
Protein ID: 161526091
SecReT6 ID239
T6SS typei4b
Gene symbol-
Locus tagBmul_2922
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome I [GenBank: NC_010084] [Browse all T6SS(s) in this replicon]
Location [Strand]3193917..3196478 [-]
ProductImpA family type VI secretion-associated protein
NoteTssI
UniProt IDA9AK57
KEGG IDbmu:Bmul_2922, bmj:BMULJ_00312
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 1.40E-67, Aligned region: 42..354
DUF2345 [PF10106], Evalue: 2.80E-59, Aligned region: 596..641
DUF2345 [PF10106], Evalue: 2.80E-59, Aligned region: 669..822
T6SS_Vgr [PF13296], Evalue: 4.60E-37, Aligned region: 525..631
Phage_base_V [PF04717], Evalue: 1.10E-19, Aligned region: 425..515
Protein Sequence: 853 a.a.     [Download]
>gi|161526091|ref|YP_001581103.1| ImpA family type VI secretion-associated protein [Burkholderia multivorans ATCC 17616]
MNVTELIQAIRGGLIQQDRLLKTDIPSLPSNALVPRRAVIRAELGRDFSVALDFVSAASDIELKTLIAKP
ITLWIQQADKSYLPINGYVHTARRLGADGSLSSYQLTFASWMHFLKFRSDMRYWQDESVDAILADVFDAH
PQAKGRYQFALSKPLPSRSYCRQSETDWNFVHRLMEDEGLFGFWRHAEDGSAHTLVVTDDLHAVDALSPN
VVRFERSGAGTETAGLTQWAASRTLQSSLHTTRTFDYKSPSSAASPNGTSLPTKSGQGHLAEQTEIYEYT
GAYTYPGQDRGEQLSKIRLEEWESRAKRFFGVGGVRGIDAGRRFTLADHPEHDRDSAQDREFAAIVVSRY
VENNLPLSDEEAHFPHSLQDELARVKAAYRDAAAFVVGHDDGSAGFYLVEVEAQRASVPYRSALVHRKPE
MQLETAVVVGPPDEEVYTDELNRIKVMFVWDRQSEGRENASCWVRVVQSDTGGGYGGVHIPRVGEEVLIG
YVGGDCDRPIALHRVYNGATAPQWHSNGILSGFRSKEYAGSGHNEMVLDDATGQNRARLFSSSANSLLHL
GYLIEQDGNTRGAYLGSGFDLRTDAYGAVRAGQGLYVTTHPKQASSQPLDVSEARQQLVNAEGLIDSMSQ
VSEMHQAAGLGDGHDALKQFADATQNSVAGATAGGGRTGGGGTGNANAFKEPVMLFGSPAGVALSSQQSI
HVSVDRQTNIVSGQSTFIASGKSLIAGIRDRISLFAQNAGMKLFAGKGKVEIQAHADSVEVTAQKVVKLM
SATEHVDVAAKQEVLLTSGGAYIRIKGGNIEIHAPGKVDFKGAQHQFSGPASMPYPLPAMPGGTCKQCVL
NAHSGREAMVEAD
 
Nucleotide Sequence: 2562 bp     [Download]
>gi|161523180|ref|NC_010084.1|:c3196478-3193917 Burkholderia multivorans ATCC 17616 chromosome 1, complete sequence
ATGAACGTGACCGAACTGATACAGGCGATTCGCGGCGGGCTGATTCAGCAGGATCGTCTGCTGAAGACCG
ACATCCCGTCGCTGCCGAGCAACGCGCTCGTGCCGCGCCGCGCAGTAATCCGCGCCGAACTGGGCCGCGA
TTTCAGCGTCGCGCTCGACTTCGTGTCCGCTGCGAGCGACATCGAGCTCAAGACGCTGATCGCCAAGCCG
ATCACGCTGTGGATCCAGCAGGCGGACAAGTCGTATCTGCCGATCAACGGATATGTGCATACCGCGCGCC
GGCTCGGCGCGGACGGCAGTCTGTCGAGCTATCAGCTGACGTTCGCGTCGTGGATGCACTTCCTGAAGTT
CCGCAGCGACATGCGCTACTGGCAGGACGAGAGCGTCGACGCGATCCTGGCCGACGTGTTCGACGCCCAT
CCGCAGGCGAAGGGTCGGTATCAGTTTGCGTTATCGAAGCCACTGCCGTCGCGCTCGTACTGCCGCCAGA
GCGAAACCGACTGGAACTTCGTGCATCGGCTGATGGAGGACGAAGGGCTGTTCGGGTTTTGGCGGCACGC
GGAAGACGGCAGTGCGCACACGCTTGTCGTGACTGACGATCTGCATGCGGTCGACGCGCTGTCGCCGAAC
GTCGTCAGGTTCGAGCGGTCAGGCGCGGGCACCGAAACCGCCGGGTTGACGCAGTGGGCCGCGTCGCGGA
CGCTGCAAAGCTCGCTGCATACGACGCGCACGTTCGACTACAAGTCGCCTTCGTCGGCCGCCAGTCCGAA
CGGCACGTCGCTGCCGACGAAGAGCGGCCAGGGCCATCTGGCGGAGCAGACGGAGATCTACGAATACACC
GGCGCGTACACGTATCCGGGCCAGGATCGCGGCGAACAGCTGTCGAAGATTCGTCTTGAGGAATGGGAGT
CGCGCGCGAAGCGCTTCTTCGGCGTGGGCGGCGTGCGCGGCATCGATGCGGGCCGGCGCTTCACGCTCGC
CGATCATCCCGAGCATGACCGCGATTCGGCGCAGGATCGCGAATTCGCGGCGATCGTCGTGAGCCGGTAT
GTCGAGAACAATCTGCCGCTTTCGGACGAGGAGGCGCACTTTCCGCACAGTCTGCAGGACGAGCTCGCGC
GGGTGAAAGCGGCGTACCGCGATGCTGCGGCATTCGTTGTCGGCCACGACGACGGCTCGGCAGGGTTCTA
TCTCGTCGAGGTCGAAGCGCAGCGCGCGAGCGTGCCGTACCGAAGCGCGCTCGTGCATCGCAAGCCGGAG
ATGCAGCTCGAGACGGCGGTCGTCGTCGGTCCGCCGGACGAGGAGGTTTACACCGACGAACTGAACCGGA
TCAAGGTGATGTTCGTGTGGGATCGGCAAAGCGAAGGCCGCGAGAACGCGTCGTGCTGGGTGCGCGTCGT
GCAGTCGGATACCGGCGGCGGTTACGGCGGCGTGCATATTCCGCGCGTCGGCGAGGAAGTGCTGATCGGC
TATGTGGGCGGCGACTGCGACCGGCCGATCGCGTTGCACCGTGTGTACAACGGCGCTACCGCGCCGCAGT
GGCACAGCAACGGGATTCTATCGGGCTTCCGGTCGAAGGAGTATGCGGGATCGGGGCACAACGAGATGGT
GCTCGACGACGCGACCGGGCAGAACCGCGCGCGGCTGTTCAGCAGCAGCGCGAATTCGCTGCTGCATCTC
GGCTATCTGATCGAGCAGGACGGCAATACGCGCGGCGCGTATCTCGGTTCGGGGTTTGACTTGCGCACGG
ACGCGTATGGCGCGGTGCGCGCGGGGCAGGGGCTGTATGTGACGACGCATCCGAAGCAGGCCAGCAGCCA
GCCGCTCGATGTGTCGGAAGCGCGGCAGCAGCTCGTCAATGCCGAGGGGCTGATCGATTCGATGTCGCAG
GTCAGCGAGATGCATCAGGCTGCGGGGCTCGGCGATGGGCACGATGCGCTGAAGCAGTTTGCAGATGCGA
CGCAGAACAGCGTCGCGGGCGCGACGGCGGGAGGAGGCAGAACCGGTGGTGGCGGGACCGGGAATGCGAA
TGCGTTCAAGGAGCCGGTGATGTTGTTTGGGAGTCCGGCGGGCGTCGCGTTATCTTCGCAGCAGTCGATA
CACGTGTCGGTCGACCGGCAGACCAATATCGTCAGCGGCCAGAGCACGTTCATTGCCAGCGGAAAATCGC
TGATTGCCGGCATCCGCGATCGCATCAGCCTGTTCGCGCAGAATGCCGGGATGAAGCTGTTTGCCGGTAA
GGGGAAGGTCGAGATACAGGCGCATGCGGATAGCGTCGAGGTCACTGCGCAGAAGGTGGTCAAGCTGATG
TCGGCAACCGAGCATGTCGACGTGGCCGCCAAGCAGGAGGTCCTGCTGACGTCGGGCGGCGCCTATATCC
GGATCAAGGGCGGCAACATCGAGATTCATGCGCCGGGGAAGGTGGATTTCAAGGGCGCGCAGCACCAGTT
CAGCGGTCCGGCGAGCATGCCGTATCCGCTGCCCGCGATGCCGGGCGGAACGTGCAAGCAGTGTGTGCTG
AATGCGCATAGCGGGCGCGAAGCAATGGTCGAGGCGGATTGA