SecReT6
Protein ID: 161526092
SecReT6 ID239
T6SS typei4b
Gene symbol-
Locus tagBmul_2923
StrainBurkholderia multivorans ATCC 17616
Repliconchromosome I [GenBank: NC_010084] [Browse all T6SS(s) in this replicon]
Location [Strand]3196547..3197668 [-]
ProductImpA family type VI secretion-associated protein
NoteTssA
UniProt IDA9AK58
KEGG IDbmu:Bmul_2923, bmj:BMULJ_00311
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 7.10E-25, Aligned region: 55..116
Protein Sequence: 373 a.a.     [Download]
>gi|161526092|ref|YP_001581104.1| ImpA family type VI secretion-associated protein [Burkholderia multivorans ATCC 17616]
MPINLPELLTPISDASPTGDDLLFSNEFDAIQEARRYDDPTLDQGEWVTEIKEADWGLVVERATDLLRTR
TKDLRVAVWLTEALALEDGITGLTEGYALLEGLCREYWDTVHPLPEGEDVEYRLGNVAWLAGRTAELLRG
IPMTDGAANAFTTLDWEVAQHVAQAIKRDPEHADDIARGKPSVEQIDASRRVTPIAFYATLLANLKAFEF
ALDAFEDTLVARAGDAAPSFRQTRDAFETVYRLAERFAREQGYTGSAPHKEAAPAAQPERIEPSFGTPIQ
TEETHVQSQTAPRPPVTQTIAGIQNRAQAVDQLRAVARYFRQTEPHSPVAYLADKAAEWADMPLHKWLES
VVKDDGSLSHIRELLGVRPDEQS
 
Nucleotide Sequence: 1122 bp     [Download]
>gi|161523180|ref|NC_010084.1|:c3197668-3196547 Burkholderia multivorans ATCC 17616 chromosome 1, complete sequence
ATGCCGATCAATCTGCCCGAGCTGCTGACGCCGATCAGCGACGCGTCGCCCACCGGCGACGACCTGCTGT
TCTCGAACGAATTCGACGCGATCCAGGAGGCGCGGCGCTACGACGATCCGACGCTCGATCAAGGCGAGTG
GGTGACCGAGATCAAGGAGGCCGACTGGGGCCTCGTCGTCGAGCGCGCGACCGACCTGCTGCGCACGCGC
ACGAAGGATCTGCGCGTCGCGGTGTGGCTGACCGAGGCGCTCGCGCTCGAGGACGGCATCACCGGTCTCA
CCGAAGGCTATGCGCTGCTCGAAGGACTGTGCCGCGAGTATTGGGACACCGTTCATCCGCTGCCCGAAGG
CGAGGACGTCGAATACCGGCTCGGCAACGTCGCATGGCTGGCCGGCCGCACGGCCGAGCTGCTGCGCGGC
ATACCGATGACGGACGGCGCGGCGAACGCGTTCACGACGCTCGACTGGGAGGTCGCGCAGCACGTGGCGC
AGGCGATCAAGCGCGATCCCGAGCATGCGGACGACATCGCGCGCGGCAAGCCGTCGGTCGAGCAGATCGA
TGCATCGCGGCGCGTGACGCCGATCGCGTTCTATGCGACGTTGCTCGCGAACCTGAAGGCATTCGAGTTC
GCGCTCGATGCGTTCGAGGACACGCTGGTCGCGCGCGCGGGCGATGCCGCGCCGAGTTTCCGGCAGACGC
GCGACGCGTTCGAGACCGTGTATCGGCTTGCCGAGCGCTTTGCGCGCGAGCAGGGCTATACCGGCAGCGC
GCCGCACAAGGAGGCGGCGCCCGCCGCGCAGCCCGAGCGCATCGAGCCGAGTTTCGGCACGCCGATTCAG
ACCGAGGAGACCCACGTGCAGTCGCAAACCGCTCCGCGTCCGCCGGTGACGCAGACGATCGCCGGCATCC
AGAACCGTGCGCAGGCCGTCGATCAGTTGCGTGCGGTCGCGCGTTACTTCCGTCAGACGGAGCCGCATAG
CCCGGTCGCCTATCTCGCCGACAAGGCGGCGGAATGGGCCGACATGCCGCTGCACAAGTGGCTCGAGAGC
GTCGTCAAGGATGACGGATCGCTGTCGCATATTCGCGAGCTGCTGGGGGTGAGGCCGGACGAGCAGTCGT
GA